(data stored in ACNUC7421 zone)

EMBL: CP002343.PE327

CP002343.PE327       Location/Qualifiers
FT   CDS_pept        364085..365692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0338"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   sma:SAV_1394 ABC transporter solute-binding protein; PFAM:
FT                   extracellular solute-binding protein family 1; SPTR:
FT                   Putative multiple sugar ABC transporter solute-binding
FT                   protein; PFAM: Bacterial extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46889"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J4"
FT                   /protein_id="ADU46889.1"
FT                   /translation="MKSRRTQAALGIVVGIAVTTAACTGGGSQTTQKPDKTAMFGSGSD
FT                   ISYAKYGSDYPSTTTKDVPGKCSYESISKRDYSDVTLKVIANAVPVMGEPAQLHAKQFH
FT                   DITGAKVDVVNVPFGELYQKILTPLQAGQAAYDVMFYPSLWIGDMAPYLAPVPQDYLQT
FT                   SGMKDVSKAFMDVATWNGTVVQYPVDGDRHYLKVRTDLLEDPKNQADYKAATGQTLEIP
FT                   KTWEEYQRVATFLTGRDFPGGRKGYGSAEVTKRDDLMFSAFISRAAAYAKNADVKGGFF
FT                   FDVETMKPLINTPGFVKALDMFKAAKSTWPPGGANFGLGDEILSFGGGQAAMSYSWDDA
FT                   FIQAQQENSSIRNKVAAAQLPGSAEVWNRKTNSWDKPSTPNQAPYFTWGWTSAVAKSSK
FT                   NQQAAFDFLCFFSNEANTSLDLTIGRFGVNPYRNSHFDAAFWEKQGWSTATAETYVKTF
FT                   ADMEKNTNRVFDLRVPGVNQYMSSLAAGVASALAGQKSSQQALDDVAKEWTDITTQVGK
FT                   DKVQAAYRNVVKLEDNVG"
     atgaagtcac gaaggaccca ggcggctctg ggcattgtcg ttgggatcgc cgtcacgacc        60
     gcagcgtgca ccggcggtgg cagccagacg acgcagaagc cggacaagac ggcgatgttc       120
     ggctctggct cggacatcag ctacgccaaa tacggctcgg actacccgag cacgaccacc       180
     aaggacgtgc ccggcaagtg cagctacgag tcgatcagca agcgtgacta ctcggacgtg       240
     accctcaagg tcatcgccaa cgccgtgccc gtcatgggcg aacccgccca gctgcacgcc       300
     aagcagttcc acgacatcac aggcgcgaag gtcgacgtcg tcaatgtccc cttcggcgag       360
     ctgtaccaga agatcctcac gcccctgcag gccggccaag ccgcgtacga cgtgatgttc       420
     tacccctcac tatggatcgg agacatggcg ccgtacctcg cgcctgtgcc gcaggactac       480
     ctgcagacct cgggcatgaa ggacgtcagc aaggcgttca tggacgtggc gacgtggaac       540
     ggcacggtcg tgcagtaccc ggtggacgga gaccgccact acctcaaggt gaggaccgac       600
     ctcctcgagg acccgaagaa ccaggctgac tacaaggccg caaccggtca gacgctggag       660
     atcccgaaga cgtgggagga gtaccagcgc gtcgccacgt tcctgacggg aagggacttc       720
     ccgggtggaa ggaaggggta cggcagcgcc gaggtcacca agcgcgacga cctgatgttc       780
     tcggcattca tcagccgggc cgccgcctat gccaagaacg cggacgtcaa gggcggattc       840
     ttcttcgacg tggagacgat gaagccgctc atcaacacac ccggattcgt caaggcgctc       900
     gacatgttca aggcagccaa gtcgacgtgg ccgccgggcg gcgcaaactt cgggctcggc       960
     gacgagatcc tctcattcgg tggcgggcag gctgcgatgt cctactcgtg ggacgacgcc      1020
     ttcatccagg cccagcagga gaacagcagc atccgcaaca aggtcgctgc cgcacagctg      1080
     cccggttctg ccgaggtttg gaacaggaag acgaacagct gggacaagcc cagcacgccg      1140
     aaccaagctc cgtacttcac ctggggctgg acctcggccg tggccaagag cagcaagaac      1200
     cagcaggcgg ccttcgactt cctctgcttc ttcagcaacg aggccaacac ctcgctcgac      1260
     ctcaccatcg gccgtttcgg ggtgaatccc taccgcaact cccacttcga cgccgcgttc      1320
     tgggagaagc agggctggag cacggcgacc gctgagacgt acgtcaagac cttcgccgac      1380
     atggagaaga acaccaaccg ggtcttcgac ctgcgcgtgc ccggagtcaa ccagtacatg      1440
     tcctcactcg cggcaggtgt cgcgtccgca cttgccggac aaaagagctc gcagcaggcc      1500
     ctggacgacg tcgcaaagga gtggaccgac atcaccacgc aggtgggcaa ggacaaggtc      1560
     caggcggcct accgcaacgt ggtgaagctc gaggacaacg tgggctaa                   1608
//

If you have problems or comments...

PBIL Back to PBIL home page