(data stored in SCRATCH zone)

EMBL: CP002343.PE328

CP002343.PE328       Location/Qualifiers
FT   CDS_pept        365781..366656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0339"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; InterPro IPR000515; KEGG: sma:SAV_1395
FT                   ABC transporter permease protein; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Putative multiple sugar ABC transporter
FT                   permease protein; PFAM: Binding-protein-dependent transport
FT                   system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46890"
FT                   /db_xref="GOA:E6S7J5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J5"
FT                   /protein_id="ADU46890.1"
FT                   /translation="MTSVRRYKAVFLLPGLLTLFFIIIFPLLFTIRVSFSSWNVSSPEL
FT                   DFIGGANFARMLQDERFRASILHLFVLAGGSVALQYLLGFALALAVWRDVRGRRFLRVL
FT                   FLVPMMTTPVVMAAIWQMIFHESLGPVNDVLTRVGLDPVGWLTSSTPSYVSLMTVEVWQ
FT                   WTPFMFLLLLAGLLSLPHEPFMAAAIDGAGPVRTFFKVTLPLMAPVSVTALIIRLIEAS
FT                   KMSDSIYVLTSGGPGSATETPGYYLYIRGLKEQQTGYSGALSITYLVLMIVTLTIVSAL
FT                   LVRAFRTKVD"
     atgacgtccg ttcggcggta caaggccgtc ttcctgctgc ccggcctgct caccctcttc        60
     ttcatcatca tcttccccct cctgttcacg atccgcgtca gcttctccag ctggaacgtc       120
     agtagcccag agctcgactt catcggcgga gccaacttcg cccggatgct gcaggacgag       180
     cggttccggg catcgatcct tcacctgttc gtcctggcgg gtggaagcgt ggccctgcag       240
     taccttctcg gcttcgctct ggctctcgcc gtgtggcgcg acgtcagggg ccgccgcttc       300
     ctgcgggtgc tgttcctagt gccgatgatg acgactccgg tcgtcatggc ggccatctgg       360
     cagatgatct tccacgagtc cctcggcccg gtgaacgacg tcttgacccg cgtcggcctc       420
     gacccggtgg ggtggctgac ctcgagcacc ccgtcctacg tctcgctcat gacggtcgag       480
     gtgtggcagt ggaccccgtt catgttcctg ttgctcctgg ccggcctgct cagcctgccc       540
     catgagccct tcatggcggc ggcgatcgac ggcgcgggcc cggtgcggac gttcttcaag       600
     gtgaccctgc cactcatggc gcccgtatcg gtcaccgccc tgatcatccg actcatcgag       660
     gcgtcgaaga tgtccgactc catctacgtc ctcacctcgg gcggccccgg ctcggccacc       720
     gagacacctg gctactacct ctacatccgg ggcctcaagg agcaacagac cggctactcg       780
     ggagccctgt ccatcacgta cctggtgctg atgatcgtca cgctgaccat cgtctccgcc       840
     ctgctcgtgc gagccttccg gacgaaagtg gactga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page