(data stored in SCRATCH zone)

EMBL: CP002343.PE331

CP002343.PE331       Location/Qualifiers
FT   CDS_pept        368581..369663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0342"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family"
FT                   /note="COGs: COG3839 ABC-type sugar transport systems
FT                   ATPase components; InterPro IPR003439: IPR013611:
FT                   IPR003593; KEGG: sma:SAV_1398 sugar ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related;
FT                   Transport-associated OB domain-containing protein; SMART:
FT                   AAA ATPase; SPTR: Putative multiple sugar ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter; TOBE domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46893"
FT                   /db_xref="GOA:E6S7J8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J8"
FT                   /protein_id="ADU46893.1"
FT                   /translation="MARIDLTDVGHAYSRGDGSEDWALKPLSLSFDSGKTYALVGPSGC
FT                   GKTTMLNIISGLIRPSQGRVSFDGVDVTARPTRHRNIAQVFQFPVIYRSMSVRDNLAFP
FT                   LECRGWEQPRIDTRVGSVAEALGLSHRLDRAARHLSADEKQLISLGRGLVRDDVAAVLM
FT                   DEPLTVIDPQLKFSLRRKIRELSEQFQPTVIYVTHDQYEAMSFAQEVLVMRHGRIMQQG
FT                   TPEQLFESPRSTYVGYFVGSPAMNYLDAAWDGSAATVAGVPVTPAWAPPVRAGARFQLG
FT                   IRPEYVRLVQRSGPNTLPATLHSVRDHGPTRVCHVDIGGQSATVKVPREHPIPSEPLLY
FT                   LEMPRAKVLPYVEGELAVVD"
     atggcacgga tcgacctgac cgatgtcggc cacgcatact cgcgcggcga cggctccgag        60
     gactgggcgt tgaagcccct cagcctctcg ttcgactccg gcaagacgta cgccctagtg       120
     ggcccgtcag gctgcggcaa gacgacgatg ctcaacatca tctccggtct gattcggccg       180
     agccagggac gggtcagctt cgacggtgtc gacgtcactg cgcggccgac gaggcaccgg       240
     aacatcgcac aggtgttcca gttccccgtc atctacagat ccatgtctgt gagggacaac       300
     ctcgcctttc ccctcgagtg ccgcggctgg gagcagccga ggatcgacac gcgcgtgggg       360
     tctgtcgcgg aggccctggg cctctcgcac cggctggacc gggccgcccg ccacctgagc       420
     gcggacgaga agcagttgat ctcactgggc cgcggactcg tgcgcgacga cgtcgcggcc       480
     gtcctgatgg atgagccgct cacggtgatc gacccccagc tgaagttctc cctgcgacgc       540
     aagatccgtg agctcagcga gcagttccag ccgacggtca tctacgtcac ccacgaccag       600
     tacgaggcca tgagcttcgc ccaggaggtc ctggtcatgc gtcatggccg gatcatgcag       660
     caaggaacac cggagcagct gttcgagagc cctcggtcca cgtacgtggg gtatttcgtc       720
     ggatcgcccg cgatgaacta ccttgatgcc gcgtgggacg gttcggccgc cacggtggcc       780
     ggagtcccgg tcacgccggc ttgggctcct ccggtccgtg ccggcgcgcg gttccagctc       840
     ggcatccgcc ccgagtacgt gcggttggtg cagcgctccg gccccaacac gctgccggcc       900
     accttgcact ccgttcgcga ccatggtccg acccgggtgt gtcatgtcga tatcggcgga       960
     cagtccgcga cggtcaaggt gccgcgcgaa catcccatac cgtcggagcc gctcctctac      1020
     ctggagatgc cacgagccaa ggtgctgccc tacgtggagg gagagctcgc ggtggtggac      1080
     tag                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page