(data stored in SCRATCH zone)

EMBL: CP002343.PE332

CP002343.PE332       Location/Qualifiers
FT   CDS_pept        complement(370918..371550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0345"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR013216;
FT                   KEGG: rop:ROP_pROB01-03010 putative methyltransferase;
FT                   PFAM: Methyltransferase type 11; SPTR: Methyltransferase
FT                   type 11; PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46894"
FT                   /db_xref="GOA:E6S7J9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J9"
FT                   /protein_id="ADU46894.1"
FT                   /translation="MKKDAYGRLARLQDAALEPLNAPLREIAVRVSGVGGGSRVLDVGC
FT                   GTGTQLERYLAAGCDVSGIDTSPAMLARARERLGSAADLRLADAQRIPFEDAMFDVVTA
FT                   TLVLHELRPLECEAVGKEMARVLTDSGRLVVIDFSPGPLRGLKGWGLRGFSVLAELTAR
FT                   HLQRSRTFLAAGGVPRLAELLGMELQHTKFVGGGNMAVYVLTRRGTG"
     atgaagaagg atgcctacgg ccgcctggcc cggttgcagg acgcggccct cgagccgctc        60
     aacgcgccgc tgcgcgaaat cgcggttcga gtgagcgggg tgggtggggg ctcacgggtg       120
     ctcgacgtcg gctgcgggac ggggacccag ctggagcggt acctcgccgc aggctgcgac       180
     gtttcgggga tcgacacctc gcccgcgatg ctggcgcggg cccgcgagag gctcggctcc       240
     gcggctgacc ttcggctcgc tgacgcccag cggattcctt tcgaggacgc gatgttcgac       300
     gtcgtcacgg ccacgctggt gctgcacgag ctgagaccgc tggagtgtga ggccgttggg       360
     aaggaaatgg cacgcgtgct caccgactcg ggacggttgg tcgtgatcga cttctccccc       420
     gggccgcttc gtggactcaa gggctgggga ctgcgagggt tctccgtgtt ggccgagctg       480
     actgcgcggc acctgcaacg ttcgcggacg ttcctcgccg caggtggggt gccccggttg       540
     gccgagttgc tcggcatgga acttcaacac acgaagtttg tgggcggcgg caacatggcc       600
     gtgtacgtcc tgacccgccg cgggactggc tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page