(data stored in ACNUC7421 zone)

EMBL: CP002343.PE336

CP002343.PE336       Location/Qualifiers
FT   CDS_pept        375110..376720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0349"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_3436 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46898"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7K0"
FT                   /protein_id="ADU46898.1"
FT                   /translation="MGATVTVNDLLDGHVALDVQCLDRIYLNGYVPNLQVPGQVVSFMT
FT                   THLGLPLPSPAIMEKIGTAFRRSVRKFADTRGVPVVKFAKGVRKVEVMRRYLNAQAKTG
FT                   ASGVAAIGVAQEYQNVYASSERQGRNGMPWFSFHKADRRVTCFYFYLWDADFGPGFIKV
FT                   CAYFPYPVKVWLNGHEWAKRQATLAGIGFTELSNGFATCDDPAALQAICDRLGPEVIGA
FT                   FFDRWMSVLPLPLTDHDRSAGYWWELSMRQVEVSRTIVFDAPRQARAFFEALVVDNLDI
FT                   GRPESVELIFTGPPKRGRPFKIGCQPKTKVVTRDTDVTVNAFFKHSRLKQYLKDGRALR
FT                   IETVINCPDDLQCHRRLIHLHELQSKARDVNARLLDTERVGQGCVLASPAFERVAQSTL
FT                   TEDGRRSPALRFGDPRVMALLGALCVGLNALGFTNRSLRAQVSHLLGVPYTVNQMSYDL
FT                   ARLRSNGLIGRRPGANTYDLTPDGQRVAIFYTKVHDRLLRPLIAANTRPAPLELRQALR
FT                   TIDRHVRGYIDTARLGTAA"
     atgggcgcga cggtgacggt caatgatctg ctcgatgggc acgtggcact ggatgtgcag        60
     tgcttggacc ggatctacct taacggctac gtgccgaacc tgcaggtgcc cggtcaggtg       120
     gtctcgttca tgaccacgca tttgggactg ccgctcccgt cgccggcgat catggagaag       180
     atcggcaccg cgtttcgccg ctcggtcagg aagttcgctg acacgcgggg tgtcccggtg       240
     gtcaagttcg ccaagggggt tcggaaggtc gaggtgatgc gccgctacct gaacgcgcag       300
     gccaagacgg gcgcgtcggg ggtggccgcg atcggggtcg cgcaggagta ccagaatgtg       360
     tacgcctcga gtgagcggca gggacgcaat gggatgccct ggttctcgtt ccacaaggcc       420
     gaccggcgtg tcacctgctt ctacttctac ctgtgggacg ccgatttcgg gccgggtttc       480
     atcaaggtct gcgcgtactt cccgtacccg gtcaaggtct ggctcaatgg gcacgagtgg       540
     gccaaacggc aagccaccct cgcggggatc gggttcaccg agctgtccaa cgggttcgct       600
     acctgcgatg accccgccgc gttgcaggcg atctgtgacc ggctcggacc ggaggtcatc       660
     ggggccttct tcgaccgctg gatgagcgtg ctgccgctgc cgctgaccga ccacgaccga       720
     agcgccgggt actggtggga gctgtcgatg cgccaggtcg aggtctcccg caccatcgtg       780
     ttcgacgccc cccgccaggc ccgcgccttc ttcgaggccc tcgtcgtgga caacctcgac       840
     atcggccggc ccgagtcggt ggagctgatc ttcaccggcc cacccaagcg cggtcgcccg       900
     ttcaagatcg gctgccagcc caagaccaaa gtcgtcaccc gcgacacaga cgtgaccgtc       960
     aacgcgttct tcaagcactc ccggctcaag cagtacctca aagacggtcg cgcgctgcgg      1020
     atcgagactg tcatcaattg ccccgacgac ctgcagtgcc accgccgcct gatccatctt      1080
     cacgagctgc agtccaaggc ccgtgacgtc aacgctcgcc tgctcgatac tgaacgtgtc      1140
     gggcagggct gtgtccttgc gagcccagcc tttgagcggg tcgcacagtc caccctcacc      1200
     gaggatggcc ggaggtcgcc cgcgctacgg ttcggagatc ctcgggtcat ggccctgctc      1260
     ggcgccctgt gtgtcggatt gaacgccctc ggattcacca accggagcct gcgcgcccag      1320
     gtgagccatc tgctcggcgt tccctacacc gtcaaccaga tgagctacga cctcgcccga      1380
     ctccgctcaa acggcctcat cggacgccga cccggagcca acacctacga cctgaccccc      1440
     gacgggcaac gcgtggcgat cttctacacc aaggtccacg accggctcct gcgcccgctg      1500
     atcgccgcca acacccgacc cgccccgctc gaactgcgcc aagccctgcg aaccatcgac      1560
     cgacacgtcc gcggctacat cgacaccgcg cggctcggaa ccgccgcgta g               1611
//

If you have problems or comments...

PBIL Back to PBIL home page