(data stored in ACNUC7421 zone)

EMBL: CP002343.PE337

CP002343.PE337       Location/Qualifiers
FT   CDS_pept        complement(377062..377325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0350"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="COGs: COG2026 Cytotoxic translational repressor of
FT                   toxin-antitoxin stability system; InterPro IPR007712:
FT                   IPR012753; KEGG: gob:Gobs_3715 addiction module toxin,
FT                   RelE/StbE family; PFAM: plasmid stabilization system; SPTR:
FT                   Addiction module toxin, RelE/StbE family; TIGRFAM:
FT                   addiction module toxin, RelE/StbE family; PFAM: Plasmid
FT                   stabilisation system protein; TIGRFAM: addiction module
FT                   toxin, RelE/StbE family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46899"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7K4"
FT                   /protein_id="ADU46899.1"
FT                   /translation="MTYRIDVAPAALRQLRKLDPAARRRVQAAIELLAEQPRPSAAKKL
FT                   TGGEGEWRVRTGDHRIIYEIHDQVLLLFVVAIGHRRDIYSRR"
     atgacctacc gaatcgacgt cgcgcccgcc gcgctgcggc agttgcgcaa gctcgaccca        60
     gccgccagac gccgggtgca ggcggcgatc gagttgctgg ccgagcagcc gcgaccctcg       120
     gcggccaaga agctgacagg cggtgaaggc gaatggcggg tccgcaccgg tgaccaccgg       180
     atcatctacg agatccacga ccaagtcctc ctcctgttcg tcgtggcgat cgggcaccgg       240
     cgagacatct acagccgccg ctga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page