(data stored in SCRATCH zone)

EMBL: CP002343.PE338

CP002343.PE338       Location/Qualifiers
FT   CDS_pept        complement(377322..377576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0351"
FT                   /product="prevent-host-death family protein"
FT                   /note="InterPro IPR006442; KEGG: aau:AAur_0708
FT                   prevent-host-death protein; SPTR: Prevent-host-death
FT                   protein; TIGRFAM: prevent-host-death family protein; PFAM:
FT                   Phd_YefM; TIGRFAM: prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46900"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7K5"
FT                   /protein_id="ADU46900.1"
FT                   /translation="MTVSDARARLADVVDAARVQHDPVYLTRRGQRVAAVIDADDLDRL
FT                   IAAAEDLADIEAARAARAEIADGEAAIPWEQVKADLGLA"
     atgaccgtca gcgatgcccg agcccggctg gccgatgtgg tggacgctgc tcgcgtccag        60
     cacgacccgg tctacctgac tcggcgcggg cagcgggtcg ccgccgtgat cgatgccgac       120
     gacctggacc ggctgatcgc cgcagccgag gacctggccg acattgaggc cgcacgagcg       180
     gcgcgcgcgg agatcgctga cggggaagca gcgatcccgt gggagcaggt caaagccgac       240
     ctcggcctgg catga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page