(data stored in ACNUC7421 zone)

EMBL: CP002343.PE34

CP002343.PE34        Location/Qualifiers
FT   CDS_pept        36223..37614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0034"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgo:TGME49_020220 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46596"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEJ5"
FT                   /protein_id="ADU46596.1"
FT                   /translation="MRHTRVGGLEVIHRLGQLGAALGYEVREEHRVGRSAAVDLSWTAA
FT                   ASNDAPLFVFEVESTPSTGLANNALKVYGSPLEELVKPLFFFHLVLSGGQDNERIRNAQ
FT                   RLFGQHNYRIYRLTDGTPAPDLALDILRQHRRVSRNLDLWSTATALMEPGWGGLATVFA
FT                   VLELAEQLRFESAYLCDYARLSMEDPAYVGLFARRVRTLSERPEANGPEGREASNPRPR
FT                   DGYGGGPGDYISGLLETGIRIYAGDLADEDGPAAFETWMTSCGFGQRMIEPSFGLSRDY
FT                   DGYVIGTAPIHYALTAALLKRHPRSHEWVIRDLANLLEGEFDRGLRPRFRLPAVLWLAH
FT                   ILAASPTEHDVATQRDPTFFDGLYARLGEHVREGGGLPAKLLLDPPRPFNPSEDVPEWI
FT                   DEEEVVSLPSREALRAKGLALRGPTVPSGHPTAIQACLSSLISYEVYADPGAVILPLLY
FT                   AEAAD"
     gtgagacaca cacgggtcgg cggcctcgag gtcatacacc ggcttggtca gttgggcgcg        60
     gccctaggct atgaggtgcg tgaagagcac cgcgtaggtc gatccgcagc tgtcgacttg       120
     tcgtggaccg cggcggcatc gaacgacgca ccccttttcg tcttcgaggt ggagagcacc       180
     ccttcaaccg gtttggccaa caacgcgctc aaggtgtatg ggagtccact cgaagaactg       240
     gtcaagccgc tcttcttctt tcacctcgtc ctgtcgggag ggcaggacaa cgagcgaatc       300
     cgcaatgccc agcggctgtt tgggcagcac aactaccgca tctaccgtct caccgatggg       360
     acgccggcac cggatctggc cttggacatt ctgcgtcagc atcgccgtgt cagccggaac       420
     ctcgatcttt ggtccacagc gactgctctc atggaacccg ggtggggcgg gcttgccact       480
     gttttcgcag ttctagagct cgccgagcag ttgcgcttcg agagcgccta cctctgtgac       540
     tacgcgcggc tgtctatgga agaccccgct tacgtcggtc tgttcgcccg ccgcgtacgc       600
     acgctatcgg agcgtcctga ggccaatggc ccggaggggc gagaagcgag caatccgcgg       660
     ccccgagatg gctacggcgg tggtccgggt gactacatct caggtttgct ggagacaggc       720
     atccgcatct atgccggcga cctggccgac gaggatgggc cggctgcatt cgaaacctgg       780
     atgacgagtt gtggattcgg ccagcgcatg atcgagccct cctttggact ctccagagat       840
     tacgacgggt atgtcatcgg cacagcccca atccactacg ccctgaccgc ggcacttctc       900
     aagcgccatc ctcgttcgca cgagtgggtc atacgtgatc tcgcgaatct gcttgaggga       960
     gagttcgacc gaggtctgcg ccctcgcttt aggctccccg ccgtactatg gctggcgcac      1020
     attctcgcgg caagcccgac cgagcacgac gtcgcgaccc aaagggaccc cacctttttc      1080
     gacggcctgt acgcccgcct cggcgagcat gtgcgcgaag gcggaggact cccagccaag      1140
     ctgctgcttg atccgccaag acccttcaac ccctccgaag atgtgcccga gtggatcgac      1200
     gaggaagagg tcgtatcgct cccgtcccgc gaagcgttgc gtgcgaaggg gctcgccctc      1260
     cgagggccga ccgtgccttc cggtcatccc acagctattc aggcttgcct cagttcattg      1320
     atctcctatg aggtctatgc agatccgggc gccgtgatcc tgccgctcct gtatgccgaa      1380
     gctgcagact ga                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page