(data stored in SCRATCH zone)

EMBL: CP002343.PE340

CP002343.PE340       Location/Qualifiers
FT   CDS_pept        complement(378130..378327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0353"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /note="KEGG: kra:Krad_2676 CopG domain protein DNA-binding
FT                   domain protein; SPTR: CopG domain protein DNA-binding
FT                   domain protein; manually curated; PFAM: Ribbon-helix-helix
FT                   protein, copG family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46902"
FT                   /db_xref="GOA:E6S7K7"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7K7"
FT                   /protein_id="ADU46902.1"
FT                   /translation="MAMNLRLTDAESEALRAKAEQEGRSMQEVARSAIAQYVSDRPQRL
FT                   AAAIQRVRTEDHDLLERLSQ"
     atggcgatga acctgcggct gaccgatgcc gaatcggaag ccctgcgcgc aaaggcggag        60
     caagagggtc gctcgatgca ggaggtggcg cgcagcgcga tcgctcaata cgtctcggac       120
     cgtccgcagc gcttggctgc cgcgatccag cgcgtgcgca ccgaggatca cgatctgctc       180
     gagcgactga gccagtga                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page