(data stored in SCRATCH zone)

EMBL: CP002343.PE341

CP002343.PE341       Location/Qualifiers
FT   CDS_pept        378326..379060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0354"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR011663; KEGG: nda:Ndas_2625 transcriptional regulator,
FT                   GntR family; PFAM: UbiC transcription regulator-associated
FT                   domain-containing protein; SPTR: Transcriptional regulator,
FT                   GntR family; manually curated; PFAM: UTRA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46903"
FT                   /db_xref="GOA:E6S7K8"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7K8"
FT                   /protein_id="ADU46903.1"
FT                   /translation="MPTWYHRGTISAERPTGRALGAPQWAERRSLSGNQARYERLGKTD
FT                   VDPYLGGEASITTEVLEYAVLEAPDSVPVLAGRSALRVLRRRATNGEPYAVIRTWMPAE
FT                   FAAAIPSTSLENASVHERFATALQRPVTGGRRQVRAVAATPQVARQLGIAEGDPLLLLE
FT                   GQSVDREGRLLEVFQTWHRADLVTFDVAATPGPRPAVTEPHPAEASVGLDQRVDAIAAA
FT                   IKSVQQSLEAIRASLDEVRRDL"
     atgcccacat ggtaccaccg cggtaccatt tcggccgagc ggccgacagg ccgcgcccta        60
     ggggccccac agtgggcgga acgacgctcc ctcagcggaa accaagctcg ttatgagcgg       120
     ctcggcaaga ccgacgttga cccgtacctg ggcggcgagg cgtcgatcac gacggaggtc       180
     cttgagtatg cagttctgga ggcccccgac tccgtacctg tacttgcagg aaggtcggct       240
     ctccgggttc ttcgccgcag agccaccaac ggtgagccct atgcggtgat ccgcacctgg       300
     atgcccgcgg agttcgctgc cgcgatccca tccacgagcc tggagaacgc atcggtccac       360
     gagcgtttcg ccacggcgct gcagcgcccg gtgaccggcg gccggcggca ggtgcgagcg       420
     gtagccgcaa cgccccaggt cgcacgacag ctcggcatcg cggagggcga cccgctgctt       480
     ctcctcgagg gccagagcgt ggaccgtgag ggccgtctcc tcgaggtctt ccagacctgg       540
     caccgtgccg acctcgtcac cttcgacgtg gcggccaccc ccggcccacg acctgccgtc       600
     accgagccgc atcccgccga agcgtcggtg gggctcgatc agcgggtcga cgcgatcgcc       660
     gctgccatca agtctgtcca gcagagcctc gaggcgatcc gtgcgtcctt ggatgaggtg       720
     cgccgcgacc tgtag                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page