(data stored in ACNUC7421 zone)

EMBL: CP002343.PE345

CP002343.PE345       Location/Qualifiers
FT   CDS_pept        complement(384810..386060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0358"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG1541 Coenzyme F390 synthetase; InterPro
FT                   IPR000873; KEGG: chl:Chy400_1182 coenzyme F390
FT                   synthetase-like protein; PFAM: AMP-dependent synthetase and
FT                   ligase; SPTR: Coenzyme F390 synthetase-like protein; PFAM:
FT                   AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46907"
FT                   /db_xref="GOA:E6S7L2"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7L2"
FT                   /protein_id="ADU46907.1"
FT                   /translation="MSVDGSHTLTEAVEAYAAELAPAVGDVVRRAASVVPAFAERVLQA
FT                   GLTVDDLAAGDLTALPILTKDDVLAQQQADPPFGGLLAPGAGVRRIFQSPGPIYEPELD
FT                   ETDPWRWASALAAAGIGSGDVVLNCFGYHLSPAGAMFEEGCRAVGAVVVPGGIGNQDLQ
FT                   ARAIADLGVTAYVGLPSYLKALIDRFDELGLPVDRWRLRKALVTAEPLPDSLRALLQER
FT                   VPTVLMSYGTAEVGLIGYETAPGSGLLPGPGLHVEVCDLATGAPVSDGEGQVVVTLQRL
FT                   DYPLIRFGTGDLSAWMTGADGSARLAGVLGRVGEAVKVKGMFLHPRQAASVMSGVGGVA
FT                   AWRFVIDRVNHKDELACEVVLDDPVNAGESGGDAERVLEQVRSSVRSGLRFAANVRRVE
FT                   ALPEGDFGRIVDARTWD"
     gtgtcggtcg atggttccca cacgctcacc gaggcagtcg aggcgtatgc cgctgagctg        60
     gctcccgctg tcggcgacgt cgtgcgccgg gctgcgtctg tcgtgccggc cttcgccgag       120
     cgcgtcctgc aggcaggtct gacggtcgac gacctggccg cgggcgacct caccgccctg       180
     ccgatcctca ccaaggacga cgtcctcgcc cagcagcagg cagacccgcc gttcggtggt       240
     ctgctcgctc ccggtgctgg cgtgcggcgg atcttccagt caccggggcc gatctacgag       300
     cccgagctcg acgagaccga cccgtggcgg tgggcgtcgg ccctggctgc cgccgggatc       360
     ggttccggcg atgtcgtcct caactgtttc ggctaccacc tgtcccccgc gggcgcgatg       420
     ttcgaggagg gctgccgtgc ggttggggcc gtggtggtgc ccggtggcat cggcaaccag       480
     gacctgcagg ccagggccat cgccgacctt ggtgtcacgg cctatgtcgg cttgcccagc       540
     tatctcaagg cgctgatcga ccggttcgac gagctcggcc tgcccgtcga ccggtggcgc       600
     ctccggaagg cgctcgtcac ggcggagccg cttccggact cgctgcgagc gctgctccag       660
     gaacgggtgc ccacggtgct gatgtcctac gggaccgccg aggtcgggct gatcggatac       720
     gagaccgcac cgggcagtgg cctgctgccg gggccgggcc tgcacgtcga ggtgtgcgat       780
     ctcgccaccg gggctccggt ctcagacggc gagggccagg tcgtcgtcac cctccagcgg       840
     ctcgactacc cgctcatccg cttcggcacc ggtgaccttt ccgcgtggat gacaggggcc       900
     gatggctcgg cgcggctggc cggggtgctc ggtcgagtcg gtgaggcggt caaggtcaag       960
     gggatgttcc ttcacccgag gcaggccgcc tccgtgatga gcggagtggg tggcgtcgcg      1020
     gcgtggcgct tcgtcatcga ccgggtcaac cacaaggacg agctggcctg cgaggtcgtc      1080
     ctcgacgacc cagtcaacgc tggtgagtca ggcggggacg ccgagcgggt cctcgagcag      1140
     gtccggtcgt cggtgcggtc ggggctgcgc ttcgcggcca acgtccggcg ggtcgaggcg      1200
     ctgcccgaag gcgacttcgg ccgcatcgtc gacgcccgca cctgggattg a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page