(data stored in SCRATCH zone)

EMBL: CP002343.PE346

CP002343.PE346       Location/Qualifiers
FT   CDS_pept        complement(386072..386926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0359"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="COGs: COG0410 ABC-type branched-chain amino acid
FT                   transport systems ATPase component; InterPro IPR003439:
FT                   IPR003593: IPR017871; KEGG: chl:Chy400_1183 ABC transporter
FT                   related; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: ABC transporter related; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46908"
FT                   /db_xref="GOA:E6S7L3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7L3"
FT                   /protein_id="ADU46908.1"
FT                   /translation="MTSTPVSGTVAGAVAPGPATTDLLTINNVEVIYDDVILVLRGLSL
FT                   AVPEGKIVALLGSNGAGKSTTLKAISGLLPTEHGEVTDGSILFGGKNVTHLDAAERVRL
FT                   GLSLCMEGRHIFEHLTVEENLISGAYFRGRIDIQSDLAEVYALLPKLSDMRARVAGYLS
FT                   GGEQQMLAIGRALMAKPKLLMLDEPSLGLAPLLVKEIFAFIKRVNEEMGLTVLVIEQNA
FT                   RRALEVADHGYIMEQGRIVLEGTAQELQENPDVKEFYLGLGESGGRKSFRDVKHYKRRK
FT                   RWL"
     atgacctcga cccctgtgag cgggacggtg gccggcgcgg tagcgcccgg gccggccacc        60
     accgacctgc tcaccatcaa caacgtcgag gtcatctacg acgacgtcat cctcgtgctc       120
     cgcgggctct cgctcgcggt gcccgagggc aagatcgtcg cgctgctcgg ctcgaacggc       180
     gccggcaagt cgacgaccct caaggcgatc tccgggctgc tcccgaccga gcacggcgag       240
     gtcaccgacg ggtcgatcct cttcggcggc aagaacgtca cccacctcga cgccgccgag       300
     cgggtccgcc tgggcctctc cctctgcatg gagggcaggc acatcttcga gcacctcacg       360
     gtcgaggaga acctcatctc cggcgcctac ttccgcgggc gcatcgacat ccagagcgac       420
     ctcgccgagg tgtatgcgct cctgccgaag ctcagcgaca tgcgggcccg ggtcgcgggc       480
     tatctctccg gcggtgagca gcagatgctc gccatcggtc gcgccctgat ggccaagccc       540
     aagctgctca tgctcgacga gccgtcgctc ggcctcgccc ccctgctcgt caaggagatc       600
     ttcgccttca tcaagcgggt caacgaggag atgggcctga ccgtcctcgt catcgagcag       660
     aacgcccggc gcgccctcga ggtcgccgac cacggctaca tcatggagca gggccggatc       720
     gtcctcgagg gcaccgccca ggagctgcag gagaacccgg acgtcaagga gttctacctc       780
     ggcctcggcg agtccggcgg gcggaagagc ttccgcgacg tcaagcacta caagcgccgc       840
     aagcgctggc tctga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page