(data stored in ACNUC7421 zone)

EMBL: CP002343.PE348

CP002343.PE348       Location/Qualifiers
FT   CDS_pept        complement(388233..389291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0361"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="COGs: COG4177 ABC-type branched-chain amino acid
FT                   transport system permease component; InterPro IPR001851;
FT                   KEGG: chl:Chy400_1185 inner-membrane translocator; PFAM:
FT                   inner-membrane translocator; SPTR: Inner-membrane
FT                   translocator; PFAM: Branched-chain amino acid transport
FT                   system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46910"
FT                   /db_xref="GOA:E6S7L5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7L5"
FT                   /protein_id="ADU46910.1"
FT                   /translation="MATATGIHHRTYRSELRLRHTKAEYFRLALMLVLLLAAPYVLDKY
FT                   WLGIANVILISVIGAVGLNILVGFTGQISLGQGGFLAVGAFTSVIISDRAGVPVPISIA
FT                   IAVLMTAAVGAFFGLPALRLKGLYLAIATLASQEIIMFVVRRWEWLTEGKGYLEVERLH
FT                   VGGFQVERQMFEVQWYWILLALATLAVVVARNLFRTTLGRSFMAVRDQDIAAEAIGVNI
FT                   TRAKVTAFAVSSGFVGLAGALTAHYTETVTWERFTLDVSVLYLAMIIVGGLGSIAGAVY
FT                   GAIFMGLLPALLTELVDVLGSSLPSLSDQLPALRNAVFGIAIIVFLLVEPRGLDRIWTR
FT                   MKDYVRFWPFRY"
     atggcgactg ccaccggcat ccaccaccgg acctaccggt ccgagctgcg gctgcgacac        60
     acgaaggcgg agtacttccg gctcgcgctc atgctcgtgc tgctcctcgc cgccccctac       120
     gtcctcgaca agtactggct cggcatcgcc aacgtcatcc tcatctcggt catcggcgcc       180
     gtcggcctca acatcctcgt cggcttcacc gggcagatct ccctcggcca gggcggcttc       240
     ctcgccgtcg gagccttcac ctccgtcatc atctccgacc gggcgggcgt gccggtgccg       300
     atcagcatcg ccatcgcggt cctcatgacc gcggccgtcg gagcgttctt cggcctgccg       360
     gccctgcggc tcaagggcct ctacctcgcg atcgcgaccc tggcgtctca ggagatcatc       420
     atgttcgtcg tacgccgctg ggagtggctg acggagggca agggctacct cgaggtggag       480
     cggctgcacg tcggcgggtt ccaggtcgag cgacagatgt tcgaggtcca gtggtactgg       540
     atcctcctcg cgctcgcgac cctcgccgtg gtcgtcgccc gcaacctctt ccggaccacg       600
     ctcggccgca gcttcatggc cgtgcgcgac caggacatcg cggccgaggc catcggtgtc       660
     aacatcaccc gcgcgaaggt cacggccttc gccgtctcga gcggcttcgt cggcctcgcc       720
     ggcgccctca ccgcgcacta caccgagacc gtcacctggg agcgcttcac cctcgacgtc       780
     tcggtgctct acctcgcgat gatcatcgtc ggtggcctcg gcagcatcgc cggcgccgtc       840
     tacggcgcga tcttcatggg cctgctcccg gccctgctca cggagctcgt ggacgtgctc       900
     ggctcgagcc tgccgtccct gtcggaccag ctcccggccc tcaggaacgc ggtcttcggc       960
     atcgcgatca tcgtcttcct cctcgtggaa cctcgaggac tcgaccggat ctggacccgg      1020
     atgaaggact acgtccggtt ctggccgttc cgctactag                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page