(data stored in ACNUC7421 zone)

EMBL: CP002343.PE355

CP002343.PE355       Location/Qualifiers
FT   CDS_pept        397612..399372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0368"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="COGs: COG0018 Arginyl-tRNA synthetase;
FT                   InterProIPR005148: IPR015945: IPR008909: IPR001278: IPR
FT                   001412; KEGG: tfu:Tfu_0269 arginyl-tRNA synthetase; PFAM:
FT                   Arginyl-tRNA synthetase, class Ic, core; arginyl tRNA
FT                   synthetase domain protein; DALR anticodon binding domain
FT                   protein; PRIAM: Arginine--tRNA ligase; SPTR: Arginyl-tRNA
FT                   synthetase; TIGRFAM: arginyl-tRNA synthetase; PFAM: DALR
FT                   anticodon binding domain; Arginyl tRNA synthetase N
FT                   terminal domain; tRNA synthetases class I (R); TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46917"
FT                   /db_xref="GOA:E6S7M2"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7M2"
FT                   /protein_id="ADU46917.1"
FT                   /translation="MVSPLVALTPKVQSAIAAALGDDFREADPVLRPSQFADVQVNAAL
FT                   ALGKKVGAAPRDVAARIVAALDLDGVAEKVEVSGPGFVNITFSDAWLASLLADVDQDDR
FT                   LGVPVEEPQNIPIDYSAPNVAKEMHVGHLRTTIVGDSLARTLEHLGHHVIRQNHIGDWG
FT                   TPFGMLIEHLLEVGEDSPEAELLVTDPNAFYQAARAKFDAAEQADPDGSAGDFDIRARA
FT                   RVVKLQAGDPETLEHWHRLVGMSKVYFNKVYQALGVTLGDENLAGESTYNHLLADVCGE
FT                   LEAKGLATVSDGALCVFLDGYTGREGKPVPLIIRKSDGGYGYPTTDLATIKYRVGDLGA
FT                   HRVLYVIGAPQALHLNMVWDTARLAGWLPDDVTPVHIQIGNVLGEDRKILKTRSGSSLR
FT                   LMALLDEAVAKARGLIDETRPDLSEEERATIARQVGIGAVKYADLSVAHNSEYVFDLDR
FT                   MVSLTGNTGPYLQYVVARVRSIFRQAGLDPLTQHAPITLGTPHERALGQQLLGFGDVVT
FT                   EVGAEYEPHRLCGYLFELAQAFSAFYENCPVLKAETPELRESRLTLSALVLRTMVTGLD
FT                   LLGLESPEQM"
     atggtctccc cgctcgtcgc gctcaccccg aaggtccagt ccgcgatcgc cgccgccctc        60
     ggtgacgact tccgcgaggc ggacccggtg ctgcgcccgt cgcagttcgc cgacgtgcag       120
     gtcaacgccg cccttgccct cggcaagaag gtcggcgcgg caccccgcga cgtggccgcg       180
     aggatcgtcg ccgccctcga cctcgacggt gtcgccgaga aggtcgaggt gagcgggccg       240
     ggcttcgtca acatcacgtt cagcgacgcc tggctcgcgt ccctcctcgc cgacgtcgac       300
     caggacgacc ggctcggcgt gcccgtcgag gagccgcaga acatccccat cgactactcc       360
     gcgcccaacg tcgccaagga gatgcacgtc ggccacctcc gcacgaccat cgtgggcgac       420
     tcgctcgccc ggaccctcga gcacctcggc caccacgtca tccggcagaa ccacatcggc       480
     gactggggca cgcccttcgg catgctcatc gagcacctcc tcgaggtggg ggaggactca       540
     cccgaggcgg agctgctcgt caccgacccc aacgccttct accaggcggc ccgggccaag       600
     ttcgacgccg ccgagcaggc cgaccccgac ggcagcgcag gcgacttcga catccgggcc       660
     cgcgcgcggg tcgtcaagct ccaggccggc gaccccgaga cgctcgagca ctggcaccgg       720
     ctcgtcggga tgtcgaaggt ctacttcaac aaggtctacc aggcgctcgg ggtcaccctc       780
     ggcgacgaga acctcgccgg cgagtcgacc tacaaccacc tgctcgccga cgtctgcggc       840
     gagctcgagg ccaagggcct ggcgaccgtc tcggatggtg cgctgtgcgt cttcctcgac       900
     ggctacaccg ggcgcgaggg caagccggtg ccgctcatca ttcgcaagtc cgatggcgga       960
     tatggttacc ccacaacgga tctcgcgacg atcaagtacc gggtcggcga cctcggagca      1020
     caccgggtgc tgtatgtcat cggcgccccg caggccctgc acctcaacat ggtgtgggac      1080
     accgcacggc tcgccggctg gctgcccgac gacgtgaccc cggtgcacat ccagatcggc      1140
     aacgtcctcg gcgaggaccg caagatcctc aagacccgtt ccggctcgtc gctgcggctc      1200
     atggcgctgc tcgacgaggc cgtcgccaag gcgcggggac tcatcgacga gacgcggccc      1260
     gacctgtccg aggaggagcg ggcgacgatc gcgcggcagg tcggcatcgg cgccgtgaag      1320
     tacgccgacc tctcggtcgc ccacaacagc gagtacgtct tcgacctcga ccggatggtg      1380
     tcgctcaccg gcaacaccgg cccgtacctc cagtacgtcg tcgcgcgggt gcggtcgatc      1440
     ttccgccagg cgggtctcga cccgctcacc cagcacgcgc cgatcaccct ggggacgccg      1500
     cacgagcggg ccctgggtca acagctgctc ggcttcgggg acgtcgtcac cgaggtgggg      1560
     gcggagtacg agccgcaccg gctctgcggc tacctcttcg agctggccca ggcgttctcg      1620
     gccttctacg agaactgccc cgtcctcaag gccgagacgc ccgagctccg cgagtcgcgg      1680
     ctgacgctca gtgcgctcgt gctgcggacc atggtgaccg gtctcgacct cctcggcttg      1740
     gagtcgcccg agcagatgtg a                                                1761
//

If you have problems or comments...

PBIL Back to PBIL home page