(data stored in ACNUC7421 zone)

EMBL: CP002343.PE356

CP002343.PE356       Location/Qualifiers
FT   CDS_pept        399501..400736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0369"
FT                   /product="transcriptional regulator, CadC"
FT                   /note="COGs: COG3710 DNA-binding winged-HTH domains;
FT                   InterPro IPR001867: IPR000073; KEGG: msm:MSMEG_3856
FT                   transcriptional regulator, CadC; PFAM: transcriptional
FT                   regulator domain-containing protein; alpha/beta hydrolase
FT                   fold; SPTR: Transcriptional regulator, CadC; PFAM:
FT                   Transcriptional regulatory protein, C terminal; alpha/beta
FT                   hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46918"
FT                   /db_xref="GOA:E6S7M3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7M3"
FT                   /protein_id="ADU46918.1"
FT                   /translation="MRFTFGDVVLDTDRFLLERGGEPVHVQPQVFDVLSHLVRHRERVV
FT                   PKTELLDAVWGNRFVTESTLTSRIKTARRVVGDDGALQRVIQTVHGRGYRWIAEVETEG
FT                   IGPGDGPDIPPDPPLRREQHIRFCEASDGVRIAYATVGEGPPLVRAAHWITHLDYEWHS
FT                   PVWRHWMEGLSRGRTFIRYDERGCGLSDHDPEDISFESFVRDLETVVDELGLERFPLMG
FT                   LSQGGPVAIEYAVRHPERVSRLILIGAFATGRLVRAGTAAELREAQMQGELMQLGWGRD
FT                   DPSFRLYFSSTFMPDAPPQMWSDFAALMRRTTSAENALRLNNVSIAMDVRESATKVSVP
FT                   TLILHGRHEVRIPFSQGRELAARIRGSRLVPLDTRNHLLQADEPAWRHLLREIDAFLAE
FT                   DESTSRPAEVHR"
     atgcggttca cgttcgggga cgtggttctc gacaccgacc ggttcctcct ggagcgcggc        60
     ggcgagccgg tgcacgtgca gccgcaggtc ttcgacgtcc tctcccacct ggtccgccac       120
     cgggagcggg tcgtgccgaa gaccgagctg ctcgatgcgg tgtggggcaa ccggttcgtg       180
     accgagtcga ccctgacgag ccggatcaag acggcccggc gcgtcgtcgg ggacgacgga       240
     gcgctccagc gagtgatcca gaccgtccac ggccgggggt accgctggat cgccgaggtc       300
     gagacggagg ggatcgggcc gggtgacgga ccggacatcc ctcccgaccc gccgctccgc       360
     agggagcagc acatccgctt ctgtgaggcg agcgacggtg tccggatcgc ctacgcaacg       420
     gtcggggagg gtccgccgct ggttcgcgca gcgcactgga tcacccacct cgactacgag       480
     tggcacagcc ctgtgtggcg ccactggatg gagggcctct cgcgcgggcg gacgttcatc       540
     cggtacgacg agcgcggctg cggactgtct gaccacgacc cggaggacat ctccttcgag       600
     tcgttcgtcc gcgacctcga gaccgtcgtc gacgagctcg ggctcgagcg gttcccgctc       660
     atggggctct cgcagggggg acccgtcgcg atcgagtacg ccgtccgcca cccggagcgg       720
     gtcagccgtc tcatcctcat cggtgcgttc gccaccggcc gcctcgtccg ggccggcacc       780
     gcggcggagc tgcgcgaggc ccagatgcag ggcgagctca tgcagctggg ctgggggcgc       840
     gacgacccgt cgttccggct ctacttctcg tccaccttca tgccggacgc cccgccgcag       900
     atgtggagcg acttcgccgc cctgatgcgg cgcacgacct cagccgagaa cgccctgcgg       960
     ctcaacaacg tctccatcgc catggacgtc cgcgagtcgg cgacgaaggt ctcggtcccc      1020
     accctgatcc tgcacggccg ccacgaggtg cggatcccgt tcagccaggg ccgggagctc      1080
     gcggcccgga tccgggggag tcggctcgtg ccgctcgaca cccgcaacca cctgctccag      1140
     gcggacgagc ccgcgtggcg gcacctcttg cgggagatcg acgccttcct cgccgaggac      1200
     gagtccacga gccgtccagc agaagtccac cgctag                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page