(data stored in SCRATCH zone)

EMBL: CP002343.PE357

CP002343.PE357       Location/Qualifiers
FT   CDS_pept        400798..402078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0370"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG0644 Dehydrogenase (flavoprotein); InterPro
FT                   IPR006076: IPR003042; KEGG: sen:SACE_3335 monooxygenase,
FT                   FAD-binding; PFAM: FAD dependent oxidoreductase; SPTR:
FT                   Monooxygenase, FAD-binding; PFAM: FAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46919"
FT                   /db_xref="GOA:E6S7M4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7M4"
FT                   /protein_id="ADU46919.1"
FT                   /translation="MNIRRAGAEAGKEPRTVTADVVVVGARVAGAATATHLARAGHDVL
FT                   MLDRGAFPSDTVSTHVIARSGMVLLSRLGVLQQLVEEGAPPLRRVEFASRLGSVQRDIK
FT                   DRYGTDFVLAPRRYALDDVLQRTALAAGARLHEGFSVDVVLTDATGRAIGVHGHDERGP
FT                   VEVRAAHVVGADGLSSRVARCLGAQPTVVRPAFGACQYAYFAGAWDAVEYHLGDGVFAG
FT                   VFPTHGGEACVWAITPEAVARRYRNGRRGGHGHPTRGGADAALAHLLRDRLPDLADRLG
FT                   PGSQQGPVRGMLRMPNHFRRAHGPGWSLVGDAGYHRDAITGHGISDALCQAELAAAAIE
FT                   ASLRCPSQEAEALADYEGHRDRMSLPIFETTVALAAFPDQSTFIELQRRLAVEIDELAE
FT                   ELYDRPLPVGAPNHPSPEMKEAATHVH"
     gtgaacatca gacgagcagg tgcggaggcc gggaaggagc cccggacggt caccgccgac        60
     gtcgtcgtcg tgggggcccg cgtggccggt gccgcgacgg ccacgcacct cgcccgggcc       120
     ggccacgacg tcctcatgct cgaccggggg gcgttcccga gcgacacggt ctcgacccac       180
     gtcatcgcgc ggtccgggat ggtcctgctc tcgcggctcg gcgttctcca gcagctcgtg       240
     gaggagggag cgccgccgct gcgccgggtg gagttcgcca gccgacttgg cagcgtgcag       300
     cgcgacatca aggaccgcta cgggaccgac ttcgtgctgg ccccgcgccg ctacgccctc       360
     gacgacgtcc tgcagcgaac ggcactcgcg gccggggccc ggctgcacga ggggttctcg       420
     gtcgacgtgg tgctcaccga cgcgaccggc agggccatcg gggtccacgg gcacgatgaa       480
     cgtgggcccg tcgaggtgcg ggcggcgcac gtcgtcgggg ccgacgggtt gagctcccgg       540
     gtggcccggt gtctgggggc gcagcccacg gtcgtgcgac cggccttcgg agcgtgtcag       600
     tacgcctact tcgcgggcgc ctgggacgcc gtcgagtacc acctcggtga cggcgtgttc       660
     gcgggtgtct tcccgaccca cggcggcgag gcgtgtgtgt gggccatcac gccggaggcc       720
     gtcgcacggc gctaccggaa tggtcgccgc ggaggccacg gccatccgac ccgtggcggc       780
     gcggacgccg ccttggctca cctgcttcgg gaccggctcc ccgacctcgc cgaccgcctc       840
     gggccaggtt cgcagcaggg tccggtgcgc ggaatgctcc ggatgccgaa ccacttccgt       900
     cgggcgcacg gaccgggctg gtcgctcgtc ggcgacgccg gctaccaccg cgacgccatc       960
     accggtcacg ggatcagcga cgccctgtgc caggcggaac tggcagcggc agcgatcgag      1020
     gcgagtctcc gctgtccttc gcaggaggcc gaggccctcg ccgactacga gggccaccgt      1080
     gaccggatgt ccctgccgat cttcgagacc accgtcgcgc tggccgcctt ccccgaccag      1140
     tcgacgttca tcgagctcca acgtcgccta gccgtcgaga tcgacgagct cgccgaggag      1200
     ctgtacgacc gcccgctccc ggtcggagca ccaaaccacc catcacccga gatgaaggaa      1260
     gcagctaccc atgtccactg a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page