(data stored in SCRATCH zone)

EMBL: CP002343.PE358

CP002343.PE358       Location/Qualifiers
FT   CDS_pept        402068..402628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0371"
FT                   /product="OsmC family protein"
FT                   /note="COGs: COG1765 redox protein regulator of disulfide
FT                   bond formation; InterPro IPR003718; KEGG: ade:Adeh_2254
FT                   OsmC-like protein; PFAM: OsmC family protein; SPTR:
FT                   OsmC-like protein; PFAM: OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46920"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7M5"
FT                   /protein_id="ADU46920.1"
FT                   /translation="MSTETAHRNGVDTPTLFATLDAVRETPAAAHFQFRAHNEWIDGTH
FT                   SLSRIHDFFGVGEERTHERVFTFDADHPAVLVGRDRGPTPVELLLHAIAACITAGIANI
FT                   ASARKVTLTEVRSTVRGDIDLNGILGLQDVRNGFQHVTVTFQVKGDAPEAVLREIVEQS
FT                   RQRSAVYDVMANGVPVDLRVEVG"
     atgtccactg agaccgcaca ccgcaacggc gtcgacacgc cgacgctctt cgccaccctc        60
     gacgccgtca gggagacgcc tgccgcggcg catttccagt tccgggcaca caacgagtgg       120
     atcgacggga cgcacagcct gtcccggatc cacgacttct tcggcgtcgg ggaggaacga       180
     acgcacgagc gggtgttcac cttcgatgcc gaccacccgg ccgtcctcgt cgggagggac       240
     cgcgggccga cacccgtcga gctcctgctt cacgcgatcg ccgcctgcat caccgccggg       300
     atcgccaaca tcgcgtcagc gcggaaggtc accctgaccg aggtccggtc gacggtgcgc       360
     ggagacatcg acctcaacgg catcctcggc ctgcaggacg tccgcaacgg cttccagcac       420
     gtgacagtga cgttccaggt caagggtgat gcccccgagg cggtgctccg cgagatcgtg       480
     gagcagtccc gacagcggtc cgccgtctac gacgtcatgg cgaacggcgt ccccgtcgac       540
     ctgcgagtcg aggtgggctg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page