(data stored in ACNUC7421 zone)

EMBL: CP002343.PE359

CP002343.PE359       Location/Qualifiers
FT   CDS_pept        complement(402730..402903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0372"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: art:Arth_2347 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46921"
FT                   /db_xref="UniProtKB/TrEMBL:E6S817"
FT                   /protein_id="ADU46921.1"
FT                   /translation="MCRPANCRTCGKTTWAGCGQHVDQVMRHVPQAQRCGGHAKESSGS
FT                   SGGVFGRLFGRG"
     atgtgccgac ccgccaactg caggacctgc ggcaagacca cctgggccgg ttgcggccag        60
     cacgtcgacc aggtgatgcg ccacgtgccc caggcacagc ggtgtggggg ccacgcgaag       120
     gagtcgtccg gttcctccgg tggcgtcttc ggccggctct tcggccgagg ctga             174
//

If you have problems or comments...

PBIL Back to PBIL home page