(data stored in SCRATCH zone)

EMBL: CP002343.PE36

CP002343.PE36        Location/Qualifiers
FT   CDS_pept        complement(40045..41025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0036"
FT                   /product="5-methylcytosine restriction system
FT                   component-like protein"
FT                   /note="COGs: COG4268 McrBC 5-methylcytosine restriction
FT                   system component; InterPro IPR019292; KEGG: nth:Nther_0806
FT                   McrBC 5-methylcytosine restriction system component-like
FT                   protein; PFAM: 5-methylcytosine restriction system
FT                   component-like protein; SPTR: McrBC 5-methylcytosine
FT                   restriction system component-like protein; PFAM: McrBC
FT                   5-methylcytosine restriction system component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46598"
FT                   /db_xref="InterPro:IPR019292"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEJ7"
FT                   /protein_id="ADU46598.1"
FT                   /translation="MHSLPELLTLAYRTLAPPPSSGVATVETTTPSEWLLVQLAREVHE
FT                   LLGRGLRNGYVERRERLPFVRGRTRPVLNPAQLPFLDCEYADFIVDTPENRLLRGVLEL
FT                   LAPAVRNRAVRRLYDDALSFLLNVEPVLPSLAQFDRISLTRLNRHYLPSLRLARLALEG
FT                   AGVVDSAGSSTAPSYFVLMWQIWENAVAAALRDAQILDVLEKPRYGSAFVHEQGQPNVS
FT                   VTLEPDLVLGRRLSPRMVIDLKWAPVLLPNRHGGLRLRNSHLYQMATYVTALDCDGLLL
FT                   YPLMDDAVNATYVFNGHRVTVRTVDLGQTGLTDLRNAAADIAAAL"
     gtgcacagct tgccggagct gctgaccctg gcataccgga cgcttgcacc gccgcccagt        60
     tctggcgtcg ccaccgtcga aacgacaacg cctagtgagt ggctgctggt gcagctcgct       120
     cgcgaggtcc atgagcttct tggccgggga cttcgcaacg gatacgttga gcggcgagag       180
     cgtctgccgt tcgtacgggg ccggacgcgc cccgtcctga accccgccca gctgcctttc       240
     ctcgattgcg agtacgccga cttcattgtt gatacgcccg agaaccgact gttgcgtggc       300
     gttctcgagc tcctggcacc agcggtacga aaccgggcgg tccggcgcct atacgacgat       360
     gccttgagct tcctcttgaa cgtggagcct gtccttccgt cgcttgccca gttcgaccga       420
     atctcactga cacgactcaa ccggcactac ctgcccagcc tacgactggc gcgtcttgcg       480
     cttgagggcg ccggtgtcgt ggactcagcg gggagcagta cagctccgtc ctacttcgtt       540
     ctgatgtggc agatctggga gaacgcggtc gcagcggccc tgcgtgacgc ccagatcctt       600
     gacgtgctgg agaagcctcg ttacgggtct gcgttcgtcc atgagcaggg tcagcccaat       660
     gtgtccgtca cacttgagcc ggatctcgtc cttgggcggc gcctttcgcc gcggatggtc       720
     atcgacctca agtgggctcc ggtcctgcta ccgaatcggc atggcggact tcggctccgg       780
     aactcgcatc tttaccagat ggcgacgtac gtgactgccc tcgattgtga cgggcttctg       840
     ctgtacccac tgatggacga tgccgttaat gcgacgtacg tgttcaacgg ccatcgagtc       900
     acggtacgga cggtcgacct ggggcagacg ggactcaccg atctgcgtaa cgcagccgct       960
     gacattgccg ctgcgcttta a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page