(data stored in ACNUC7421 zone)

EMBL: CP002343.PE360

CP002343.PE360       Location/Qualifiers
FT   CDS_pept        403048..403422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0373"
FT                   /product="thioredoxin"
FT                   /note="COGs: COG3118 Thioredoxin domain-containing protein;
FT                   InterProIPR017936: IPR013766: IPR017937: IPR006662: IPR
FT                   005746; KEGG: nml:Namu_1297 thioredoxin; PFAM: Thioredoxin
FT                   domain-containing protein; SPTR: Thioredoxin; TIGRFAM:
FT                   thioredoxin; PFAM: Thioredoxin; TIGRFAM: thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46922"
FT                   /db_xref="GOA:E6S818"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6S818"
FT                   /protein_id="ADU46922.1"
FT                   /translation="MSTRNLTYADFESVVSAEGIVLVDFWASWCGPCRMFAPVYEAASE
FT                   THADITFGKVDTEAEQQLAAAARITSIPTLMAFRDGILVFSQPGALPAAALEQVVQAVR
FT                   DLDMEDVRRQVEAQSAKADA"
     atgagcaccc gaaacctgac ctacgccgac ttcgagtccg tcgtctccgc agagggcatc        60
     gtcctcgtcg acttctgggc ctcgtggtgc gggccgtgcc gcatgttcgc gcccgtctat       120
     gaggccgcat cggagaccca tgccgacatc accttcggca aggtcgacac cgaagccgag       180
     cagcagctcg ccgccgcggc gcggatcacc tccatcccga ccctgatggc cttccgcgac       240
     ggcatcctcg tcttcagcca gcccggggcg ctgcccgccg ctgccctcga acaggtcgtc       300
     caggccgtcc gtgacctcga catggaggac gtccggcgcc aggtcgaagc gcagagcgca       360
     aaggctgacg cctga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page