(data stored in ACNUC7421 zone)

EMBL: CP002343.PE362

CP002343.PE362       Location/Qualifiers
FT   CDS_pept        complement(404156..405307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0375"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="COGs: COG1960 Acyl-CoA dehydrogenase; InterPro
FT                   IPR006092: IPR006091: IPR006090: IPR006089; KEGG:
FT                   nca:Noca_4293 acyl-CoA dehydrogenase domain-containing
FT                   protein; PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; SPTR: Acyl-CoA dehydrogenase; PFAM: Acyl-CoA
FT                   dehydrogenase, C-terminal domain; Acyl-CoA dehydrogenase,
FT                   middle domain; Acyl-CoA dehydrogenase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46924"
FT                   /db_xref="GOA:E6S820"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E6S820"
FT                   /protein_id="ADU46924.1"
FT                   /translation="MDLSLNEDQLGFKALAREFLDKEVVPHRAEWDRRESVDTAIIPRL
FT                   GEIGFFGLTIPEEYGGLGGDYITYCIGMEELGRADSSVRGIVSVSMGLVGKVILSHGTE
FT                   EQKHQYLPGIANGTLLGCFGLTEPDNGSDPGNLKTRARRDGSDYVINGQKIFITNGTWA
FT                   DVCLVFARTGGDGPKGVSAFLVPTDSPGFEAREIHGKLGLRGQATAEIFLTDVRVPESA
FT                   RLGAEGEGFKIAMHSLDKGRVSVGAGCTGIIQGCLEEVVKYTTERKQFGRPIASFQLIQ
FT                   EIIAEISVDVDAARLLTWRAADLIERGEPFGVEASKAKYFASEAAVRAANGALQAFGGY
FT                   GYVDEYPIQKYMRDARVMTLYEGTSQIQKLLIGRAETGISAFL"
     atggacctgt ccctcaacga ggaccagctc ggcttcaagg cgctggcgcg cgagttcctg        60
     gacaaggagg tcgtccccca ccgggccgag tgggaccgcc gcgagtccgt cgacacggcg       120
     atcatcccca ggctcggcga gatcggcttc ttcggcctga cgatccccga ggagtacggc       180
     gggctcggcg gcgactacat cacctactgc atcggcatgg aggagctcgg ccgtgccgac       240
     tcctcggtcc gcgggatcgt ctccgtctcc atgggcctgg tgggcaaggt gatcctgtcg       300
     cacggcaccg aggagcagaa gcaccagtac cttcccggca tcgccaacgg cacgctcctc       360
     ggctgcttcg gactcaccga gccggacaac ggctcggacc cgggcaacct caagacccga       420
     gcgcggcgcg acggctcgga ctacgtcatc aacgggcaga agatcttcat caccaacggc       480
     acctgggcgg acgtctgcct cgtcttcgcc cgcaccggcg gcgacggccc caagggcgtc       540
     tcggcgttcc tcgtgccgac cgactcgccc ggcttcgagg cgcgggagat ccacgggaag       600
     ctcggcctcc gcggccaggc gaccgccgag atcttcctca ccgacgtccg cgtgcccgag       660
     tccgcccgct tgggtgctga gggtgagggc ttcaagatcg cgatgcactc gctcgacaag       720
     gggcgcgtgt ccgtcggcgc gggctgcacc ggcatcatcc agggctgcct cgaggaagtc       780
     gtgaagtaca cgaccgagcg caagcagttc ggccgcccca tcgcgtcctt ccagctgatc       840
     caggagatca tcgccgagat ctcggtcgac gtggacgccg cccgcctgct cacctggcgc       900
     gcagccgacc tcatcgaacg gggcgaaccc ttcggcgtcg aagcctccaa ggcgaagtac       960
     ttcgcgtcag aggctgccgt gcgggcggcc aacggcgccc tgcaggcctt cggtggctac      1020
     ggctacgtcg acgagtaccc catccagaag tacatgcgcg acgcccgggt catgacgctc      1080
     tacgaaggca ccagccagat tcagaagctg ctcatcgggc gagccgagac gggaatcagc      1140
     gcctttctct ga                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page