(data stored in ACNUC7421 zone)

EMBL: CP002343.PE364

CP002343.PE364       Location/Qualifiers
FT   CDS_pept        complement(406204..407403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0377"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /EC_number="2.3.1.9"
FT                   /note="COGs: COG0183 Acetyl-CoA acetyltransferase;
FT                   InterProIPR020616: IPR020617: IPR002155: IPR020615: IPR
FT                   020610: IPR001412: IPR020613: IPR012793; KEGG:
FT                   nml:Namu_0875 beta-ketoadipyl CoA thiolase; PFAM:
FT                   Thiolase-like; SPTR: Beta-ketoadipyl CoA thiolase; TIGRFAM:
FT                   beta-ketoadipyl CoA thiolase; acetyl-CoA acetyltransferase;
FT                   PFAM: Thiolase, C-terminal domain; Thiolase, N-terminal
FT                   domain; TIGRFAM: acetyl-CoA acetyltransferases;
FT                   beta-ketoadipyl CoA thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46926"
FT                   /db_xref="GOA:E6S822"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E6S822"
FT                   /protein_id="ADU46926.1"
FT                   /translation="MSTAYLVAGVRTPIGRYAGGLAPVRTDDLAAHAVSSLVDRFPAID
FT                   WGRVDDVILGCANQAGEDNRNVARMAGLLAGLPVQVPGLTVNRLCASGLDAVGAAARAI
FT                   RAGDADLVIAGGVESMTRAPLVMPKPDSAWSRRAEVHDTTIGWRFVNPRMDERYGTDSM
FT                   PGTAQIVADEYDISREDQDAFALRSQERAAKAIASGRLAREIVPVEIQGRKGAVSVVDT
FT                   DEHPRTTSLEALANLRPIFPGGSVTAGNASGVNDGAAALLVASEAAVSRYGLTPLARIT
FT                   TSLSVGVEPRVMGMGPDPAVKALLARTGLEVGDIDLFELNEAFASQSLAVLRALGLPDD
FT                   AEHVNPNGGAIALGHPLGMSGARLALTAAVELADRGVRRALATMCVGVGQGGALLLEAV
FT                   "
     gtgagcaccg cctatctcgt cgcgggtgtc cgcaccccca ttggcaggta tgccggtggg        60
     ctggctcccg tgcgcaccga tgacctcgct gcccacgccg tctcttcgct cgtcgaccgc       120
     ttcccggcca tcgactgggg ccgcgtcgac gacgtcatcc tcggctgcgc gaaccaggcg       180
     ggggaggaca accgcaacgt cgctcgcatg gccgggctgc tcgcaggact tcccgtccag       240
     gtgcctggcc tgaccgtcaa ccgactctgc gcttctggtc tggacgccgt cggagccgcc       300
     gcacgagcga ttcgggccgg tgacgccgac ctcgtcatcg ccggcggggt cgagagcatg       360
     acgagggccc cactggtcat gccgaagccc gactcggcat ggtcgcgccg ggccgaggta       420
     cacgacacga cgatcggctg gcggttcgtc aacccgcgca tggatgagcg ctacggcacc       480
     gactccatgc cgggcaccgc acagatcgtc gccgacgagt acgacatctc ccgcgaggac       540
     caggacgcgt ttgcgctgcg gtcccaggag agggcggcga aagcgatcgc ctccggtcgg       600
     ctggcgcgcg agatcgttcc cgtcgagatc cagggccgca agggtgccgt cagcgtcgtg       660
     gacaccgacg agcacccccg gaccacgtcg ctcgaggccc tcgccaacct gcggccgatc       720
     ttccccggcg gcagcgtcac cgcaggcaac gcgtcggggg tcaatgacgg agcagcagcg       780
     ctcctcgtcg cgtccgaggc ggcggtgtcg cgctacggac tcacgccgct ggcccggatc       840
     accacctcgc tctcggtcgg ggtcgagccg cgcgtgatgg gaatgggacc cgaccccgcg       900
     gtcaaggccc tgctggctcg gaccgggctg gaggtcgggg acatcgacct cttcgagctc       960
     aacgaggcat tcgcctcgca gtcgctcgcc gtgctccgcg cgctcggcct cccggacgac      1020
     gcggagcacg tcaaccccaa cggtggcgcc atcgccctcg gacaccccct cggaatgagt      1080
     ggtgcccggc tggcgctcac ggcggctgtg gagctcgccg accggggcgt acgtcgggcc      1140
     ctcgccacca tgtgtgtcgg ggtcggccag ggcggcgccc tcctgctgga ggcggtgtga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page