(data stored in SCRATCH zone)

EMBL: CP002343.PE365

CP002343.PE365       Location/Qualifiers
FT   CDS_pept        complement(407400..409025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0378"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG0318 Acyl-CoA synthetase
FT                   (AMP-forming)/AMP-acid ligase II; InterPro IPR000873:
FT                   IPR020845; KEGG: nca:Noca_4296 cyclohexanecarboxylate-CoA
FT                   ligase; PFAM: AMP-dependent synthetase and ligase; SPTR:
FT                   AMP-dependent synthetase and ligase; PFAM: AMP-binding
FT                   enzyme; TIGRFAM: cyclohexanecarboxylate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46927"
FT                   /db_xref="GOA:E6S823"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6S823"
FT                   /protein_id="ADU46927.1"
FT                   /translation="MTFETRLNDELIAKYTDGGFWVNRLITDYLDEWAERTPDKVAFID
FT                   SRRQVTYAELRAEVDRCALGLLELGIEPGDVVSFQLPNWIDWVVLHYACTRIGAISNPL
FT                   IPIYREREVAFMVGLAGSKLIVVPREFRGFDHVSLVESLKPDWPALDHILVVGGPEAPA
FT                   SWEVFMSTPWEERRDPAELAALRPDPNDVTLLIFTSGTTGEPKGVMHSHNTVVAANNPL
FT                   PERLGISTESVIHMASTLAHLTGFLYGARLPVQNGATGILQDIWDPKEFIGLVERHGIT
FT                   YTSAATPFLHDVLSVPDVNQHPMSTLSRFCCMGAPIPRALVRRAKELLPSMAVLGGWGQ
FT                   TENALVTLGIPGDPEEKVVETDGYPWPGMQIRTVDFDGVPVPAGTEGRLQVQGPFLFVG
FT                   YANRMKMTQDSFEGDWFDTGDLAIIDEDGYVKLSGRTKDVIIRGGENIPVAYVENALYE
FT                   DPRIESVAIVGLPDPRLQERAAAVVTLTPGSTLSFEEMQVLLKEKGIAKQYWPERLEVI
FT                   DALPRTASGKIQKFQLRDRFGETS"
     atgaccttcg agacacgcct caacgacgag ctgatcgcga agtacaccga tggcgggttc        60
     tgggtgaacc gcctcatcac cgactacctc gacgagtggg ccgagcgcac accggacaag       120
     gtggccttca tcgactcccg tcgtcaagtc acctacgcgg agctccgcgc cgaggtcgac       180
     cgctgcgcgc tcgggcttct cgagctgggc atcgagccgg gtgacgtcgt gtcgttccag       240
     ctgcccaact ggatcgattg ggtggtcctg cactacgcct gcacgcggat cggcgcgatc       300
     agcaaccccc tcatcccgat ctaccgggag cgagaggtcg cgttcatggt cgggctggcc       360
     ggctcgaagc tcatcgtcgt cccgcgcgag ttcaggggct tcgaccacgt ctcgctggtg       420
     gagtcgctca agcccgactg gccggccctc gaccacatcc tggtcgtcgg cggccccgag       480
     gcgcccgcct cctgggaggt gttcatgtcg acgccatggg aggagcggcg cgaccccgcc       540
     gagttggccg cgctgcggcc cgaccccaac gacgtgacgc tgctcatctt cacctccggg       600
     accaccggtg agcccaaggg cgtcatgcac tcgcacaaca ccgtcgtcgc tgccaacaac       660
     ccccttccag agcgcctcgg catctccacc gagagcgtca tccacatggc ttcgacgctg       720
     gcccacctga ccggattcct ttacggcgca aggctgcccg tgcagaacgg cgccacgggc       780
     attctccagg acatctggga ccccaaggag ttcatcggcc tcgtcgagcg acacggcatc       840
     acctacacgt cggccgcgac gccgttcctg cacgacgtcc tgtccgtgcc ggacgtcaac       900
     cagcacccga tgagcacgct gtcgcggttc tgctgcatgg gcgccccgat cccccgcgcc       960
     ctggtgaggc gggccaagga gctcctcccg agcatggcgg tgctcggcgg ctggggccag      1020
     accgagaacg ccctcgtcac cctcggcatc ccgggcgacc ccgaggagaa ggtcgtcgag      1080
     accgacggct acccctggcc cggcatgcag atccggaccg tcgacttcga cggcgtgccg      1140
     gtacccgcgg gcacggaggg ccgcctccag gtccagggac cgttcctctt cgtcggctac      1200
     gcgaaccgga tgaagatgac gcaggacagc ttcgaggggg actggttcga caccggcgac      1260
     ctcgcgatca tcgacgagga cggctacgtc aagctgtccg gccgcaccaa ggacgtcatc      1320
     atccgcggtg gtgagaacat cccggtcgcc tacgtggaga acgccctgta cgaggacccg      1380
     cggatcgagt ccgtcgccat cgtcggcctg cccgacccgc ggctccagga gcgcgcggct      1440
     gcggtggtca cgctcacccc gggctcgacg ctgagcttcg aggagatgca ggtcctcctc      1500
     aaggagaagg ggatcgccaa gcagtactgg cccgagcggc tggaggtcat cgatgccctg      1560
     ccccgcaccg cgagcggcaa gatccagaag ttccagctcc gtgaccgctt cggggagacg      1620
     tcgtga                                                                 1626
//

If you have problems or comments...

PBIL Back to PBIL home page