(data stored in ACNUC7421 zone)

EMBL: CP002343.PE369

CP002343.PE369       Location/Qualifiers
FT   CDS_pept        411964..412566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0382"
FT                   /product="transcriptional regulator"
FT                   /note="COGs: COG1309 Transcriptional regulator; InterPro
FT                   IPR001647: IPR006665; KEGG: nml:Namu_0880 transcriptional
FT                   regulator, TetR family; PFAM: regulatory protein TetR;
FT                   SPTR: Transcriptional regulator, TetR family; PFAM:
FT                   Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46931"
FT                   /db_xref="GOA:E6S827"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:E6S827"
FT                   /protein_id="ADU46931.1"
FT                   /translation="MATAVTRQERMQRRRVEIIQAAVELFQELGFHAATTHQVAERAGL
FT                   SVGLIYQYFGNKEDLLRSVIVDILGQFRDRIPSAIAAAGPDPVARLRAGYRAYVDVIDE
FT                   NREGALLTYREGLTLSPDGRDEIKKLEIETAAPLRDVILEGIASGAFTDVDAELVVHNL
FT                   VLTAHGWALKHWRLAKTYDVDGYADRQLDLLLRAIRP"
     gtggcaaccg cggtcacgcg ccaggagcgc atgcagcgcc gccgggtgga gatcatccag        60
     gccgcggtcg agctcttcca ggagctcggg ttccacgcgg ccaccactca tcaggtggcc       120
     gagcgagccg gcctgagtgt cggcctgatc taccagtact tcggcaacaa ggaagacctg       180
     ctgcgctccg tcatcgtcga catcctcggg cagttccggg accggatccc gtcggccata       240
     gcggcggccg gtcccgaccc cgtggctcgt ctccgggcgg gctaccgggc ctacgtcgac       300
     gtcatcgacg agaaccggga gggcgcgctg ctcacctacc gcgagggcct caccctgtcg       360
     ccggacggcc gcgacgagat caagaagctc gagatcgaga ccgccgcgcc gctccgggac       420
     gtcatcctcg aggggatcgc gtcaggcgcc ttcaccgacg tggacgccga gctcgtggtc       480
     cacaacctcg tgctcactgc ccatggctgg gcactgaagc actggcgcct cgcgaagacc       540
     tacgacgtcg acggctacgc cgaccgtcag ctcgatctgc tgctccgcgc catccgcccc       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page