(data stored in ACNUC7421 zone)

EMBL: CP002343.PE370

CP002343.PE370       Location/Qualifiers
FT   CDS_pept        complement(412642..413391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0383"
FT                   /product="respiratory nitrate reductase gamma subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="COGs: COG2181 Nitrate reductase gamma subunit;
FT                   InterPro IPR003816; KEGG: nca:Noca_1349 respiratory nitrate
FT                   reductase gamma subunit; PFAM: Nitrate reductase gamma
FT                   subunit; PRIAM: Nitrate reductase; SPTR: Respiratory
FT                   nitrate reductase gamma subunit; TIGRFAM: respiratory
FT                   nitrate reductase, gamma subunit; PFAM: Nitrate reductase
FT                   gamma subunit; TIGRFAM: respiratory nitrate reductase,
FT                   gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46932"
FT                   /db_xref="GOA:E6S828"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:E6S828"
FT                   /protein_id="ADU46932.1"
FT                   /translation="MSTFLWVIFPYICLAVFVVGHWWRYRYDKFGWTTRSSQLYESRML
FT                   RWGSPLFHFGLLGVVGGHVIGLVIPQSWTEAVGMSETLYHWVAVIGGMISGLMVLAGLV
FT                   ILIYRRRTVGPVFSATTPMDKTMYFFLALVIVLGMWNTIASSIFGLGGSEGHAFNYRES
FT                   VSLWFRQIFYGQPDPGLMANAPLGFQLHALVAFFLFALWPFTRLVHVFSAPLGYVTRPY
FT                   IVYRSKDEREGTAVGTRAPKRGWERVQ"
     atgagcacct ttctctgggt gatcttcccg tacatctgcc tggcggtctt cgtcgtcggc        60
     cactggtggc gttaccgcta cgacaagttc ggctggacga cccgcagctc gcagctctac       120
     gagtcacgca tgctgcggtg gggttcgccg ctcttccact tcgggctgct cggcgtcgtc       180
     ggcggccatg tcatcgggct ggtcatcccg cagtcgtgga ccgaggccgt ggggatgagc       240
     gagaccctct accactgggt cgccgtcatc ggcgggatga tctccggcct catggtgctt       300
     gcgggactcg tcatcctcat ctaccgccgg cgcaccgtgg gtccggtctt ctccgccacg       360
     acgcccatgg acaagacgat gtacttcttc ctcgccctcg tcatcgtcct cggcatgtgg       420
     aacaccatcg cctcgagcat cttcgggctc ggcggcagcg aggggcacgc gttcaactac       480
     cgcgagagcg tctcgttgtg gttccggcag atcttctacg gccagcccga tcccgggctc       540
     atggccaacg ccccgctcgg gttccagctg catgcgctcg tcgcgttctt cctcttcgcg       600
     ctgtggccgt tcacccgcct ggtccatgtc ttctcggccc cgctcggcta cgtcacccgg       660
     ccctacatcg tctaccgcag caaggacgag cgcgagggaa ccgcggtggg cacccgggcg       720
     ccgaagcgcg gatgggaacg cgtgcagtag                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page