(data stored in ACNUC7421 zone)

EMBL: CP002343.PE371

CP002343.PE371       Location/Qualifiers
FT   CDS_pept        complement(413388..414164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0384"
FT                   /product="nitrate reductase molybdenum cofactor assembly
FT                   chaperone"
FT                   /note="COGs: COG2180 Nitrate reductase delta subunit;
FT                   InterPro IPR020945: IPR003765; KEGG: nca:Noca_1348
FT                   respiratory nitrate reductase chaperone NarJ; PFAM:
FT                   TorD-like chaperone; SPTR: Putative nitrate reductase delta
FT                   subunit; TIGRFAM: nitrate reductase molybdenum cofactor
FT                   assembly chaperone; PFAM: Nitrate reductase delta subunit;
FT                   TIGRFAM: nitrate reductase molybdenum cofactor assembly
FT                   chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46933"
FT                   /db_xref="GOA:E6S829"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="InterPro:IPR042290"
FT                   /db_xref="InterPro:IPR042291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S829"
FT                   /protein_id="ADU46933.1"
FT                   /translation="MNPFRRLAKSQSSRLRDDHLQAAWQAVSLLLDYPSEESVGRHPLI
FT                   RRAIAPLPDAVRMPLTSFLDHVASQPLQAVQREYVETFDHTRKCCLYLTYFTFGDTRRR
FT                   GVALVQFKQAFQKSGVELSADELPDHLGVVLEFGATADREAAWKLLGDYRAGIEMLQVA
FT                   LDDRTSPWSAVIEALRATLPELDGDGLTAVARLIEAGPPQEEVGLDGYALDPRLTENPA
FT                   ERHPNPSGALAPVSPPTTRVTESVSLGSTIRVGAPS"
     atgaacccgt tccggcgcct cgcgaagtcc cagtcgtccc ggctgcgcga cgaccacctg        60
     caggccgcgt ggcaggcggt ctccctgctg ctcgactacc cgagcgagga gtccgtcggc       120
     cggcacccgc tcatccgccg cgccatcgct ccgcttcccg acgccgtccg tatgccgctc       180
     acctccttcc tcgaccacgt ggcctcccag cccctccagg ctgtccaacg cgagtacgtc       240
     gagacgttcg accacacccg caagtgctgc ctctacctca cgtacttcac gttcggtgac       300
     acccgacgtc gtggcgtggc gctcgtgcag ttcaagcagg cgttccagaa gtcgggggtc       360
     gagctgtccg cggacgagct gcccgaccac ctcggggtgg tcctggagtt cggcgcgacc       420
     gccgaccgtg aggcggcgtg gaagctgctc ggcgactacc gggccggcat cgagatgctc       480
     caggtcgccc tggacgaccg gacctcaccg tggtcagcgg tcatcgaggc cctccgcgcc       540
     acgctgcccg agctcgacgg cgacggcctc actgcggtcg cccgcctcat cgaggcaggc       600
     ccaccacagg aggaggtcgg tctggacggt tacgcgctcg acccacgcct caccgagaac       660
     ccggccgagc ggcatccgaa cccatccggg gcgctggccc cggtgtcccc cccgacgacc       720
     cgcgttaccg agtccgtctc cctcggcagc acgatccgcg taggagcccc gtcatga          777
//

If you have problems or comments...

PBIL Back to PBIL home page