(data stored in ACNUC7421 zone)

EMBL: CP002343.PE372

CP002343.PE372       Location/Qualifiers
FT   CDS_pept        complement(414161..415813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0385"
FT                   /product="respiratory nitrate reductase beta subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="COGs: COG1140 Nitrate reductase beta subunit;
FT                   InterPro IPR017896: IPR006547; KEGG: kfl:Kfla_4151 nitrate
FT                   reductase, beta subunit; SPTR: Nitrate reductase, beta
FT                   subunit; TIGRFAM: nitrate reductase, beta subunit; TIGRFAM:
FT                   nitrate reductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46934"
FT                   /db_xref="GOA:E6S830"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="UniProtKB/TrEMBL:E6S830"
FT                   /protein_id="ADU46934.1"
FT                   /translation="MKIMAQMAMVMNLDKCIGCHTCSVTCKQAWTNRAGTEYVWFNNVE
FT                   TRPGLGYPRTYEDQETWEGGWVRKANGRLTLRAGGRWKKLATIFSNPKLPSIEDYYEPW
FT                   TYDYATLLSSPASSTFPVARPQSLISGKQMNIQWSANWDDDLGGSLEHAAKDPMLKGIE
FT                   DKVKFEFEQTFMFYLPRICEHCLNPSCAASCPSGAIYKRSEDGIVLVDQDKCRGWRMCV
FT                   SGCPYKKVYFNHKTGKAEKCTFCYPRIEVGIPTVCAETCVGRLRYIGLMLYDADKVLEA
FT                   ASVENDHDLYEAQRDVFLDPNDPAVAHAAEQAGIPLDWIEAAKKSPVRRLIQDYKVALP
FT                   LHPEYRTMPMVWYIPPLSPVVDVVRDTGFDAEDKGNLFAAIEALRIPVEYLANLFTAGD
FT                   VEPVNDVLRKLAAMRSFMRDINLGGDPDASIAEAVGMDAESMYEMFRLLAIAKYDDRYV
FT                   IPTAHVEQAHGLEELATECPVDFDYEPTTGIFGEGSGDLTPVAVENFRMLEERQKSDEL
FT                   VAGGSKRGRVNLLNWDGKGAPRGLFPHRKKQDR"
     atgaagatca tggcccagat ggcgatggtg atgaacctcg acaagtgcat cggctgccac        60
     acgtgctccg tcacgtgcaa acaggcgtgg accaaccgcg ccggcaccga gtacgtctgg       120
     ttcaacaacg tcgagacgcg tcccggtctc ggctaccccc gtacctacga ggaccaggag       180
     acctgggagg gcggctgggt ccgcaaggcc aacgggcgcc tgacgctcag ggccggcgga       240
     cggtggaaga agctcgcgac gatcttctcc aaccccaagc tgccctcgat cgaggactac       300
     tacgagccgt ggacctacga ctacgcgacc ctgctcagct cgcccgcgtc gagcacgttc       360
     ccggtcgcga ggccgcagtc gctcatcagc ggcaagcaga tgaacatcca gtggtcggcg       420
     aactgggacg acgacctcgg cgggagcctc gagcacgccg ccaaggaccc gatgctcaag       480
     ggcatcgagg acaaggtgaa gttcgagttc gagcagacct tcatgttcta cctgccgcgg       540
     atctgcgagc actgcctcaa cccgagctgt gcggcgagct gcccgagcgg ggccatctac       600
     aagcgcagtg aggacggcat cgtcctcgtc gaccaggaca agtgccgcgg gtggcggatg       660
     tgcgtgtccg gctgccccta caagaaggtc tacttcaacc acaagaccgg caaggccgag       720
     aagtgcacct tctgctaccc gcgcatcgag gtcggcatcc cgacggtctg cgcggagacg       780
     tgcgtcggcc ggctgcgcta catcggcctc atgctctacg acgccgacaa ggtgctcgag       840
     gcggcctcgg tcgagaacga ccacgacctc tacgaggccc agcgtgacgt cttcctcgat       900
     cccaacgatc cagcggtggc gcacgcggcc gagcaggccg gcatcccgct cgactggatc       960
     gaggcggcga agaagtcccc ggtgcggcga ctcatccagg actacaaggt ggccctgccg      1020
     ctgcacccgg agtaccgcac catgcccatg gtctggtaca tcccgccgct gtcacccgtc      1080
     gtggacgtcg tgcgtgacac cggcttcgac gccgaggaca agggcaacct cttcgcggcc      1140
     atcgaggcgc tgcgcatccc ggtggagtac ctcgccaacc tcttcacggc cggcgacgtc      1200
     gagccggtca acgacgtgct gcgcaagctc gccgcgatgc gctccttcat gcgcgacatc      1260
     aacctcggcg gggacccgga cgcctcgatc gccgaggcgg tcggcatgga cgccgagtcg      1320
     atgtacgaga tgttccgcct cctcgcgatc gcgaagtacg acgaccgcta cgtcatcccg      1380
     acggcccacg tcgagcaggc ccacggcctc gaggagctcg cgaccgagtg tcccgtggac      1440
     ttcgactacg agccgacgac ggggatcttc ggggagggat ctggcgacct gacgcccgtc      1500
     gcggtcgaga acttccggat gctcgaggag cgccagaagt ccgacgagct ggtggccggc      1560
     ggctcgaagc gaggccgcgt caacctgctc aactgggatg gcaagggggc cccgcggggc      1620
     ctgttcccgc accggaagaa gcaggaccga tga                                   1653
//

If you have problems or comments...

PBIL Back to PBIL home page