(data stored in ACNUC7421 zone)

EMBL: CP002343.PE373

CP002343.PE373       Location/Qualifiers
FT   CDS_pept        complement(415840..419550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0386"
FT                   /product="respiratory nitrate reductase alpha subunit
FT                   apoprotein"
FT                   /EC_number="1.7.99.4"
FT                   /note="COGs: COG5013 Nitrate reductase alpha subunit;
FT                   InterPro IPR006656: IPR006657: IPR006655: IPR006468; KEGG:
FT                   nca:Noca_1346 respiratory nitrate reductase alpha subunit
FT                   apoprotein; PFAM: molybdopterin oxidoreductase;
FT                   molydopterin dinucleotide-binding region; PRIAM: Nitrate
FT                   reductase; SPTR: Respiratory nitrate reductase alpha
FT                   subunit apoprotein; TIGRFAM: nitrate reductase, alpha
FT                   subunit; PFAM: Molybdopterin oxidoreductase; Molydopterin
FT                   dinucleotide binding domain; TIGRFAM: respiratory nitrate
FT                   reductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46935"
FT                   /db_xref="GOA:E6S831"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:E6S831"
FT                   /protein_id="ADU46935.1"
FT                   /translation="MNASPTGLTETGLDGPLSEALVGTRRFFTKAKVSEDKRSMEAKGG
FT                   RTGDAFYRDRWSHDKVVRSTHGVNCTGSCSWKVYVKDGIITWEAQQTDYPSPGADRPDY
FT                   EPRGCPRGAAFSWYTYSPTRVRYPYVRGVLLEMYRAAKSAHGGDPVLAWGSIVEDPDKS
FT                   RRYKKARGKGGLVRATWEEVTELVAAAHVYTVKRFGPDRIAGFSPIPAMSPVSYASGAR
FT                   FLELVGAPMLSFYDWYADLPNASPQMFGDQTDVPESGDWWDAGYLIMWGSNVPLTRTPD
FT                   AHWMTEARYRGQKVLAVAPDYAENVKFADEWVTTAPGTDGALAMGMGHVILKEYFVDQQ
FT                   VPFFADYNKRFTDLPYLISLVRGDDGTYRPGKYLVAGDIEGGPKSDSENAMWKPAVLDA
FT                   ATGEVAIPNGSIGDRFGDEGLGRWNLELGDLDPALSLYGHHDEAVEVSLPRFDAADGRV
FT                   AHESRGVPVRRVGDHVVTTVFDLLLAQYGVAREGLPGAWPTGYDDPSVPATPAWQQQHT
FT                   SVPAEQVTRLAREWAQNAIDTTGRGMILLGAGTNHWFHSDQIYRAILLLTTITGTQGRN
FT                   GGGWAHYVGQEKIRPIMGFQHMAFALDWQRPPRHMNQTAYWYVHTSQYRYDTFSADDLD
FT                   SGTGVFAGKSVMDLLAQSVRLGWTPSYPTFDRSSLDLADDAEAAGMEPPAYVVQQLKEG
FT                   KLHFAVEDPEAENNYPRILSLWRSNLLGSSAKGNEYFLRHLLGTDSAATAEEAGPDQRP
FT                   ATIRWADEAGEGKLDLLMTIDFRMTSSTIFSDVVLPAATWYEKHDLSTTDMHPFIHSFN
FT                   PAINPPWQTKSDWDAWKAVAKKFSELAVDHLGTRKDVVAKPLWHDTPEAMATVHGVVKD
FT                   WRAGECEPVPGKTMPVLAVAERDYTAIYDKMITIGPLLEKVGMLTKGVAYDVKREVEIL
FT                   RGRNGVQHGGVGNGQPKVETDVQMADAMLHLAGVSNGHLATQGFRFLEKRTGTQLADLA
FT                   AEHEGKQITFADTQVAPVPVITSPEWSGSESGGRRYSPFTINIERSKPFHTLTGRQQFY
FT                   VDHDWFLGMGEMLPVYRPPLNMTTLFGESPIGEQNELGVSVRYLTPHNKWSIHSEYQDN
FT                   LFMLSLSRGGQSVWMSDRDAAKIGVKDNDWIEMVNRNGVVAARAIVSHRMPEGTVYMHH
FT                   AQDRLIDVPLTERDHKRGGIHNSLTRILLKPNHIVGGYAQLAYFFNYIGPIGNNRDEVT
FT                   MIRRRTAPVEY"
     atgaacgcct ccccgaccgg cctcaccgag acgggcctcg acggcccctt gagcgaggct        60
     ctcgtcggaa ctcgccggtt cttcaccaag gcgaaggtgt ccgaggacaa gcggagcatg       120
     gaggccaagg gcgggcgcac cggcgacgcc ttctaccgtg accgctggag ccacgacaag       180
     gtggtgcgct ccacgcacgg cgtcaactgc accggttcct gctcgtggaa ggtgtacgtc       240
     aaggacggca tcatcacgtg ggaggcgcag cagaccgact acccgagccc cggtgcggac       300
     cgaccggact acgagccgcg cggctgcccg cgcggcgctg ccttcagctg gtacacctac       360
     tcgcccaccc gggtccggta cccgtacgtg cgcggtgtcc tgctggagat gtaccgggcc       420
     gccaagtcgg cccacggcgg tgaccccgtg ctggcgtggg ggtccatcgt cgaggacccc       480
     gacaagtcgc ggcgctacaa gaaggcgcgc ggcaagggcg gtctcgtgcg ggccacctgg       540
     gaggaggtga ccgagctcgt cgccgccgcg cacgtgtaca ccgtcaagcg gttcggcccc       600
     gaccggatcg ccggcttctc ccccatcccg gcgatgtcgc ccgtgtccta tgcgtccggc       660
     gcccgcttcc tcgagctcgt cggcgcgccg atgctctcct tctacgactg gtatgccgac       720
     ctgcccaacg cgtcgcccca gatgttcggt gaccagaccg acgtgcccga gtcgggcgac       780
     tggtgggacg ccggctacct catcatgtgg ggctccaacg tgccgctcac ccgcacgccc       840
     gacgcccact ggatgaccga ggcgcgttac cggggccaga aggtcctcgc cgtcgcgccc       900
     gactacgccg agaacgtcaa gttcgccgac gagtgggtca ccacggctcc gggcaccgac       960
     ggcgccctcg ccatggggat gggacacgtc atcctcaagg agtacttcgt cgaccagcag      1020
     gtccccttct tcgccgacta caacaagcgg ttcaccgacc tgccctacct gatcagcctc      1080
     gtccgcggcg acgacggcac gtaccgaccc ggcaagtacc tggtcgccgg cgacatcgag      1140
     ggtggcccca agtccgactc cgagaacgcc atgtggaagc ccgccgtcct cgacgcggcc      1200
     acgggagagg tcgcgatccc caacggctcg atcggcgacc gcttcggcga cgaggggctc      1260
     ggccgctgga acctcgagct cggtgacctc gaccccgcac tgagcctgta cggccaccac      1320
     gatgaggccg tcgaggtctc gctcccgcgc ttcgacgccg cggacggcag ggtcgcccac      1380
     gagagccgcg gagtgcccgt gcgccgcgtc ggcgaccacg tcgtgaccac ggtgttcgac      1440
     ctgctgctcg cccagtacgg cgtggcccgg gagggccttc ccggagcgtg gccgaccggc      1500
     tacgacgacc cgtcggtccc ggcgacgccc gcctggcagc agcagcacac ctccgtgccg      1560
     gccgagcagg tcacgcgact ggcccgggag tgggcgcaga acgcgatcga caccaccggc      1620
     cgcggaatga tcctgctcgg ggcggggacc aaccactggt tccacagcga ccagatctac      1680
     cgcgcgatcc tgttgctgac gacgatcacc gggacccagg gccgcaacgg cggcggttgg      1740
     gcgcactacg tcggccagga gaagatccgg cccatcatgg gcttccagca catggccttc      1800
     gccctcgact ggcagcgtcc gccgcggcac atgaaccaga cggcctactg gtatgtccac      1860
     acgtcccagt accgctacga cacgttcagc gccgacgacc tcgactccgg caccggcgtg      1920
     ttcgccggca agagcgtcat ggacctgctc gcgcagtcgg tgcgcctcgg ctggacgccc      1980
     agctacccga cgttcgaccg cagctcgctc gacctcgccg acgacgccga ggccgccggc      2040
     atggagccgc cggcctacgt cgtgcagcag ctcaaggagg gcaagctgca cttcgccgtc      2100
     gaggaccccg aggccgagaa caactaccct cgcattctct cgctgtggcg ctccaacctg      2160
     ctcggcagct cggcgaaggg caacgagtac ttcctccggc acctgctcgg aaccgacagc      2220
     gccgcaacgg ccgaggaggc cgggccggac cagcgcccgg ccacgatccg gtgggccgac      2280
     gaggcgggcg agggcaagct cgacctgctc atgaccatcg acttccgcat gacgagctcg      2340
     acgatcttca gcgacgtcgt gctgcccgcg gccacgtggt acgagaagca cgacctcagc      2400
     acgaccgaca tgcacccctt catccactcg ttcaacccgg cgatcaaccc gccgtggcag      2460
     acgaagtcgg actgggacgc gtggaaggcc gtggcgaaga agttcagcga gctggcggtc      2520
     gaccacctgg gcacccggaa ggacgtcgtc gccaagcccc tctggcacga caccccggag      2580
     gccatggcga cggtgcacgg tgtggtcaag gactggcggg cgggcgagtg cgagccggtc      2640
     cccggcaaga ccatgccggt cctcgccgtc gcggagcgcg actacacggc catctacgac      2700
     aagatgatca cgatcggccc gctgctggag aaggtcggca tgctgaccaa gggcgtcgcc      2760
     tacgacgtca aacgggaggt cgagatcctg cgcggccgca acggcgtcca gcacggcggg      2820
     gtcgggaacg gccagccgaa ggtcgagacc gacgtccaga tggccgacgc gatgctccac      2880
     ctggccggcg tgtccaacgg ccacctggcg acccaggggt tccggttcct cgagaagcgg      2940
     accggcaccc agctggccga cctcgccgcc gagcacgagg gcaagcagat caccttcgcc      3000
     gacacgcagg tcgcccccgt cccggtcatc acgtcgccgg agtggtccgg gtcggagtcc      3060
     ggtggtcggc gctacagccc gttcacgatc aacatcgagc ggagcaagcc gttccacacg      3120
     ctcaccggcc ggcagcagtt ctacgtcgac cacgactggt tcctcggcat gggcgagatg      3180
     ctcccggtct accggccgcc gctgaacatg acgacgctct tcggggagag cccgatcggc      3240
     gagcagaacg agctcggggt gtcggtgcgc tacctgacgc cgcacaacaa gtggtcgatc      3300
     cactcggagt accaggacaa cctcttcatg ctctcgctgt cccgcggcgg ccagtccgtg      3360
     tggatgagcg accgcgacgc ggcgaagatc ggggtgaagg acaacgactg gatcgagatg      3420
     gtcaaccgca acggcgtcgt cgcggcgcgg gccatcgtca gccaccggat gccggagggc      3480
     acggtctaca tgcaccacgc gcaggaccgg ctcatcgacg tgccgctgac cgagcgggac      3540
     cacaagcgcg gtggcatcca caacagcctg acgcgaatcc tgttgaagcc caaccacatc      3600
     gtcggcggat atgcccagct ggcctacttc ttcaactaca tcggccccat cggcaacaac      3660
     cgggacgaag tcaccatgat ccgtcgccgc acggcgcccg tcgagtactg a               3711
//

If you have problems or comments...

PBIL Back to PBIL home page