(data stored in ACNUC7421 zone)

EMBL: CP002343.PE374

CP002343.PE374       Location/Qualifiers
FT   CDS_pept        complement(419547..420362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0387"
FT                   /product="putative transcriptional regulator"
FT                   /note="COGs: COG2345 transcriptional regulator protein;
FT                   KEGG: nca:Noca_2106 transcriptional regulator; SPTR:
FT                   Transcriptional regulator; PFAM: IclR helix-turn-helix
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46936"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S832"
FT                   /protein_id="ADU46936.1"
FT                   /translation="MAQTASVSAGPGTDLLGSPVRRTIVDTLANLPTGVDPESGAVIPH
FT                   PGLRAQDLANRLGLHVTTVRFHLDQLVAAGLLRTSFQRRKEAGRPRKLYAIEQGSLGHV
FT                   TSDQSYRMLTELLVETLSSGSDAMPNTPEEAGARWGRRHVLDGHVGLIGQQAARSPGRW
FT                   LGKIGQMVDLLREWGYSPEVSTTNDGRTARVALHDCPFLPLAKDNTAVVCGIHRGLIRG
FT                   VLEALGEDSTEVGLTPFVAPSLCIAALTTHSSFEHPTTLNHPPRQGDHP"
     gtggcacaaa ccgcgagtgt gagcgccggt cccggcactg acctgctggg atcgcccgtt        60
     cgcaggacga tcgtcgacac tctcgccaac ctcccgacgg gcgtcgaccc cgagagcggc       120
     gccgtcatcc cccacccggg gctgcgggcg caggacctgg ccaaccggct cggccttcac       180
     gtgacgacgg tccggttcca cctcgaccag ctcgtcgccg ccgggctgct gcggacctcc       240
     ttccagcgtc ggaaggaggc gggacgcccg cgcaagctct atgcgatcga gcaggggtcg       300
     ctcggccacg tcacctccga ccagtcctac cggatgctga ccgagctgct cgtcgagacg       360
     ctcagctcgg gcagcgatgc gatgcccaac acgcctgagg aagccggcgc ccgctggggt       420
     cgtcggcacg tcctcgacgg ccacgtcggg ctcatcggcc agcaggcggc ccggtccccc       480
     ggccggtggc tcggcaagat cggccagatg gtcgacctgc tccgggagtg ggggtacagc       540
     cccgaggtgt cgacgacaaa tgacggtcgc accgcccggg tcgccctcca cgactgcccc       600
     ttcctgcccc tcgccaagga caacacggcc gtcgtctgcg ggatccaccg cgggttgatc       660
     cggggagtcc tggaggccct gggcgaggac tcgaccgagg tcggcctcac ccccttcgtc       720
     gcccccagcc tctgcatcgc cgccctgacc acccactcga gcttcgagca ccccaccacg       780
     ctcaaccacc cgcctcgaca aggagatcac ccatga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page