(data stored in SCRATCH zone)

EMBL: CP002343.PE376

CP002343.PE376       Location/Qualifiers
FT   CDS_pept        422196..423590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0389"
FT                   /product="nitrate/nitrite transporter-like protein"
FT                   /note="COGs: COG2223 Nitrate/nitrite transporter; KEGG:
FT                   saq:Sare_0190 nitrate/nitrite transporter-like protein;
FT                   SPTR: Nitrate/nitrite transporter-like protein; PFAM: Major
FT                   Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46938"
FT                   /db_xref="GOA:E6S834"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6S834"
FT                   /protein_id="ADU46938.1"
FT                   /translation="MTTKTAPATGEWLEAWDPENEQTWDKSLAWRTLWVTTFVLTLAFI
FT                   AWFLPSAIIPKLNLLGYSFSKGQLYWMAAMPGLAAGLLRLVWMVLPPIMGTRKMVSLTS
FT                   LLLIASTLGWGVRVQSPTAPYWELMVLAFLAGIGGGAFSGFMPSTSYFFPRRMQGTALG
FT                   LQAGIGNFGVSIVQLLTPYLIAIGALGIFGGSQMLEMPGKPTQQVWYQNAAFVWIPLMV
FT                   VGAILAWTMLKSVPIKANVRQQFDIFSNQDTWWMTLLYIMTFGTFSGLSAQFGLLMANL
FT                   YGIGNSEIVKGAGASATLLIDGYAVPDVVKFVFLGPLVGAGARVLFSPLTDRMGGAKWT
FT                   LVSALGLIASIAYTIPALTPDTSSAAALDSGFTRFLWGMLAIFLFAGIGNASTFKQMPM
FT                   IFERRQAGGVIGWTAAIAAFGPFLFGVGLTIMSPTMFYILGIAWAVMCTGIIWWRYARP
FT                   GAPKPG"
     atgacgacca agaccgcacc cgccacgggg gagtggctcg aggcctggga tcccgagaac        60
     gaacagacct gggacaagtc cctggcctgg cgcaccctct gggtcacgac gttcgtcctg       120
     accctggcgt tcatcgcctg gttcctgccg agcgccatca tccccaagct caacctgctc       180
     ggctactcgt tcagcaaggg ccagctctac tggatggcgg ccatgcccgg cctcgctgcc       240
     ggtctgctgc gactggtctg gatggtgctg ccgcccatca tgggcacccg gaagatggtc       300
     tcgctgacct cgctcctgct catcgcctcc accctcggtt ggggcgtccg ggtccagagc       360
     ccgacggcac cgtactggga actcatggtc ctcgccttcc tcgccggcat cggtgggggt       420
     gccttctccg gtttcatgcc gagcacctcc tacttcttcc cgcggcgcat gcagggcacg       480
     gcgctcgggc tgcaggccgg catcggaaac ttcggcgtct cgatcgtcca gctcctcacg       540
     ccatacctca tcgccatcgg cgcgctcggc atcttcgggg gcagccagat gctcgagatg       600
     ccgggcaagc cgacccagca ggtctggtac cagaacgccg ccttcgtgtg gatcccgctc       660
     atggtggtcg gcgcgatcct cgcgtggacg atgctcaagt cggtcccgat caaggcgaac       720
     gtccgacagc agttcgacat cttcagcaac caggacacct ggtggatgac gctgctctac       780
     atcatgacct tcggtacctt ctccggcctg tcggcccagt tcggtctgct catggccaac       840
     ctgtacggca tcggcaacag cgagatcgtc aagggcgcgg gggcctcggc caccctgctc       900
     atcgacggct acgccgtgcc cgacgtggtc aagttcgtct tcctcggccc cctcgtcggt       960
     gccggcgccc gcgtcctgtt ctcgccgctc accgaccgga tgggcggcgc caagtggacg      1020
     ctcgtctcgg cgctcggcct gatcgcctcg atcgcctaca cgatcccggc gctgaccccc      1080
     gacacgtcgt cggccgctgc gctggacagt ggcttcacca ggttcctctg ggggatgctc      1140
     gcgatcttcc tcttcgccgg catcggcaac gcgtcgacgt tcaagcagat gccgatgatc      1200
     ttcgagcggc gccaggccgg cggtgtcatc gggtggacgg cggccatcgc cgcgttcggt      1260
     ccgttcctct tcggtgtggg cctgaccatc atgtcgccga cgatgttcta catcctcggc      1320
     atcgcctggg cggtcatgtg caccgggatc atctggtggc gctacgcccg tccgggtgcc      1380
     ccgaagccgg gctga                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page