(data stored in ACNUC7421 zone)

EMBL: CP002343.PE377

CP002343.PE377       Location/Qualifiers
FT   CDS_pept        complement(423762..424580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0390"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="COGs: COG1024 Enoyl-CoA hydratase/carnithine
FT                   racemase; InterPro IPR001753: IPR018376; KEGG: cur:cur_1929
FT                   enoyl-CoA hydratase/isomerase family protein; PFAM:
FT                   Enoyl-CoA hydratase/isomerase; SPTR: Enoyl-CoA hydratase;
FT                   PFAM: Enoyl-CoA hydratase/isomerase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46939"
FT                   /db_xref="GOA:E6S835"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E6S835"
FT                   /protein_id="ADU46939.1"
FT                   /translation="MSSDASAAHLSCTVEAGIARVELNRPDKLNGLTLDMLEALATTAR
FT                   RLRDDRALRAVILSGAGDSFCAGLDFATVLKNPRAIATAFVPRPWLGTNTFQEASWAWR
FT                   RLPVPVVAAVHGHCFGGGVQIALGADFRFTTPDAKWSVLEAKWGLIPDMSGIQSLTEVV
FT                   GLDVAKRLTMTGAVISGEEAAAIGLATGVADDPRAAADELVAQIMTRSPDAVAAAKRLF
FT                   DGTWSAGPRRTFARERAEQLRLLLRTPNTRHAQRAALGTETAHFGPRHKR"
     atgtcgagcg acgcgtccgc agcccatctt tcctgcaccg tcgaggccgg catcgcaagg        60
     gtagagctga accgccccga caagctcaac gggctcacgc tggacatgct cgaggccctg       120
     gcgaccaccg cgaggcggct tcgggacgac cgggcgctgc gcgccgtcat cctctccggc       180
     gccggcgact cgttctgtgc cggcctggac ttcgccaccg tcctcaagaa cccgagggcg       240
     atcgcgaccg ccttcgtgcc gaggccgtgg ttggggacca acaccttcca ggaggcctcc       300
     tgggcttggc gccggctgcc ggtgcctgtc gtcgcggccg tgcacggcca ctgtttcggc       360
     ggcggcgtgc agatcgcgct gggcgccgac ttcaggttca ccacaccgga cgccaagtgg       420
     tcggtgctcg aggccaagtg gggactcatc ccggacatgt cggggatcca gagtctcacc       480
     gaggtggtcg ggctcgacgt cgcgaaacgc ctcaccatga ccggtgcggt gatctccggg       540
     gaggaggcgg ccgccatcgg gctggccacc ggcgtcgccg acgaccctcg ggccgccgcg       600
     gacgagctcg tcgctcagat catgacccgg tcgcccgatg ccgtcgcggc ggccaagcgc       660
     ctcttcgacg gcacctggtc cgccggcccg cgacgaacct tcgcccggga gcgggccgag       720
     cagctgcgcc tcctgctgcg gacgcccaac acccgacacg cccaacgggc ggccctcggc       780
     accgagacgg cccacttcgg cccgcggcac aagcgctga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page