(data stored in ACNUC7421 zone)

EMBL: CP002343.PE38

CP002343.PE38        Location/Qualifiers
FT   CDS_pept        complement(43100..44020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0038"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="COGs: COG0863 DNA modification methylase; InterPro
FT                   IPR002941: IPR002052: IPR001091; KEGG: bph:Bphy_3423 DNA
FT                   methylase N-4/N-6 domain-containing protein; PFAM: DNA
FT                   methylase N-4/N-6 domain protein; SPTR: DNA methylase
FT                   N-4/N-6 domain protein; PFAM: DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46600"
FT                   /db_xref="GOA:E6SEJ9"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEJ9"
FT                   /protein_id="ADU46600.1"
FT                   /translation="MTPFVFGHAELVHTDCLTWLRRRPEKSIHAVVTDPPYGATEYTHE
FT                   QQQKLRAGKGGVWRIPPAFDGHRRAPLPRFTTMSRADLDYMHDFFYAWAEVLRPTLVPG
FT                   AHVMVACNPLVSPYISMALTKAGLERRGEIVRLVMTMRGGDRPKNAHEEFVDATVMPRS
FT                   QWEPWLLYREPLECRTVADNLRKYKTGALRRISDAQPFGDVIKSHPTRKLERQIANHPS
FT                   LKPQSFLRAVVRASLPLGEGIILDPFAGSGSTLAAAEAIGYQSIGLERDAEYFEVARQA
FT                   IPQLARLVVAGVEQVSEPIPDDDDR"
     ttgaccccct tcgtcttcgg acacgcggag ctggtccaca cagactgtct gacctggctc        60
     aggaggcgac ccgagaaatc gatccacgcg gtcgtcactg acccgccgta tggagcgacg       120
     gagtataccc acgagcagca gcagaagctg cgggccggca aggggggtgt gtggcgcatc       180
     ccacccgcat tcgatggcca caggcgagca ccgctgccgc ggtttacgac gatgagccgg       240
     gctgaccttg attacatgca tgatttcttc tacgcctggg ctgaagtgct ccgtccgacg       300
     ctcgtacctg gggcgcacgt gatggtggcc tgcaatccat tggtgtcgcc gtatatttcc       360
     atggcgctga cgaaggccgg gctggagagg cgcggggaaa tcgttcggct ggtgatgaca       420
     atgcgcggag gtgacaggcc gaagaacgcc cacgaagagt ttgttgatgc aaccgtgatg       480
     cctcggtctc agtgggagcc gtggctgctg taccgggagc cattagagtg caggacggtc       540
     gcagacaatc tacggaagta caagaccggt gcgctgcggc gaatctcaga cgctcagccc       600
     ttcggggatg tgattaagtc gcacccgacc cgcaagttgg aacgtcagat cgccaaccac       660
     ccgagtctga aaccacaatc gtttctgcgc gctgtagtac gagcgtcctt acccttgggc       720
     gaaggcatca tactcgatcc cttcgcagga tcgggctcta cactcgctgc agccgaggcc       780
     atcgggtacc agtcgattgg cctggagaga gacgctgagt acttcgaggt ggctaggcag       840
     gccatccccc agctcgcgcg gctcgttgtg gccggcgtcg agcaagtatc tgaaccgata       900
     ccggatgatg acgatcgcta g                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page