(data stored in ACNUC7421 zone)

EMBL: CP002343.PE380

CP002343.PE380       Location/Qualifiers
FT   CDS_pept        427927..428526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0393"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="InterPro IPR001387; KEGG: bcv:Bcav_3642
FT                   transcriptional regulator, XRE family; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein; SPTR: Transcriptional regulator, XRE
FT                   family; manually curated; PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46942"
FT                   /db_xref="GOA:E6S838"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6S838"
FT                   /protein_id="ADU46942.1"
FT                   /translation="MNPAFDASAHVTRARRRADLSQRELAARLGVSQSVVNRWEGGSPM
FT                   SVNRLVTILALAGLRLCVVDGSGRQVDPTPSDVVRDNAGRRFPSHLDVDPPERVPAERV
FT                   LMPRRDRPDPRGWYRLRDKRDARRLSEGAPTDHPTVSGELSRRLDEVRRQRLRARARAR
FT                   EEALPECECLDGCFELACLPGCSCQCEPDRSSGRVS"
     atgaacccag cctttgacgc atcggcgcac gtgacgcggg cccgacgtcg ggcagacctg        60
     agccagcgcg agctggccgc tcgactgggg gtttcgcagt cagtggtgaa ccgctgggaa       120
     gggggctctc cgatgagcgt caaccgtctg gtgacgatcc tcgccctcgc gggactgcgg       180
     ctctgcgtcg tcgacgggtc cgggcggcag gttgacccga cgccctccga cgtggtgcga       240
     gacaacgcgg gccgtcggtt tcccagtcac ctcgatgtgg acccgccaga gcgcgtgccg       300
     gcggagcgag tgttgatgcc ccgacgcgac cggccggacc cgcgaggctg gtaccgactt       360
     cgcgacaagc gggatgcgcg gcggctgagc gagggcgctc ccacggacca ccccactgtc       420
     agcggtgagc tgtctcgaag gctcgacgag gtgcgtcgtc aacgcctccg cgcccgtgct       480
     cgcgccaggg aggaagccct gcccgagtgc gagtgcctcg atggctgctt cgagctcgcc       540
     tgcctcccag gatgttcctg ccagtgcgag ccggaccggt cgagcggaag agtctcgtga       600
//

If you have problems or comments...

PBIL Back to PBIL home page