(data stored in ACNUC7421 zone)

EMBL: CP002343.PE381

CP002343.PE381       Location/Qualifiers
FT   CDS_pept        complement(428546..429445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cfl:Cfla_0847 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Bacterial membrane
FT                   flanked domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46943"
FT                   /db_xref="GOA:E6S839"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:E6S839"
FT                   /protein_id="ADU46943.1"
FT                   /translation="MAILRRSDEIPSGLSPILLPGEQLVTAVHSHWARLVKPVSISALA
FT                   LTIAIVVDANLTPATQPVGNALWLLFFITVVWLLWRILEWRNDWFVATDKRLLLRYGII
FT                   THKVAMMPLIKVTDMSYVRSISGLLFGYGRFIMESAGQDQALRTVEWVPRPDETYRAIC
FT                   AVIFNIGPPPGTATVVEVDDGPEQTPPEGAGPEGGSGGPGGTGGRGGPTDPGGQGAEGN
FT                   PGTRAYGTPSYPDVPPIHNPIQDRLDQYSRAIPIRRVRGGEPLYESDDIRRRRRSADTG
FT                   PVPIRQQDRRPRHEPRSD"
     atggcgatcc tgcggcgcag cgacgagatc ccctcaggtc tctcaccgat cctcctgccc        60
     ggagagcagc tcgtcacagc agtgcactcg cactgggccc gactggtcaa accggtctcg       120
     atcagcgccc tcgccctgac gatcgcgatc gtcgtcgacg ccaacctcac cccggccacc       180
     cagccggtgg gcaacgcgct ctggctgctc ttcttcatca ccgtggtgtg gttgctctgg       240
     cggatcctcg aatggcgtaa cgactggttc gtcgcgaccg acaagcgcct cctgctgcgc       300
     tacgggatca tcactcacaa ggtcgccatg atgcccctga tcaaggtgac cgacatgagc       360
     tatgtcaggt cgatatcggg cctcctgttc ggttacggcc ggttcatcat ggagagcgcc       420
     gggcaggacc aggccctgcg gaccgtcgag tgggtccccc ggccggatga gacctaccgg       480
     gccatctgcg ccgtcatctt caacatcgga ccgccgcccg ggaccgcgac cgtcgtcgag       540
     gtcgatgacg gcccggagca gactccgccc gagggagccg ggcccgaagg cggttccggc       600
     ggccctggag gcacgggcgg tcgaggaggc ccgactgacc cgggcggtca aggagctgag       660
     gggaacccgg gaacgcgcgc gtacggaacg ccgtcctacc ccgacgtgcc accgatccac       720
     aacccgatcc aggaccggct cgaccagtac tcgcgggcga tacccatccg gcgcgtccgc       780
     ggcggtgagc cgctctacga gagtgatgac atccgccgca gacggaggtc ggccgacacc       840
     ggacccgtcc ccatccgtca gcaggaccgc cgtccgcggc acgagccgcg gagcgactga       900
//

If you have problems or comments...

PBIL Back to PBIL home page