(data stored in SCRATCH zone)

EMBL: CP002343.PE387

CP002343.PE387       Location/Qualifiers
FT   CDS_pept        433481..433747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0400"
FT                   /product="hydrogenase (NiFe) small subunit HydA"
FT                   /note="KEGG: rca:Rcas_3148 hydrogenase (NiFe) small subunit
FT                   HydA"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46949"
FT                   /db_xref="UniProtKB/TrEMBL:E6S845"
FT                   /protein_id="ADU46949.1"
FT                   /translation="MKQAIGAAAVISLAAVLHVSASIGASAHNRAHIILPSGECLIVGS
FT                   EKSVTLPDGSLHDLRPETYPADEIGTAYAADEGNSFLLKGACP"
     atgaagcagg caatcggagc agcagcagtg atctcactcg ccgccgtgtt acacgtttcg        60
     gccagcatcg gcgcatctgc acacaaccgg gcgcacatca tcctgccctc gggcgagtgc       120
     ctgatcgttg gttccgagaa gtccgtgacc ctcccggacg gatctctgca cgacctgcgc       180
     ccggaaacct atccggccga tgagatcggc actgcgtatg cggccgatga gggcaactcc       240
     ttcctcctca agggcgcgtg cccgtaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page