(data stored in ACNUC7421 zone)

EMBL: CP002343.PE388

CP002343.PE388       Location/Qualifiers
FT   CDS_pept        complement(434318..434944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0401"
FT                   /product="Methyltransferase type 11"
FT                   /note="InterPro IPR013216; KEGG: afw:Anae109_4039
FT                   methyltransferase type 12; PFAM: Methyltransferase type 11;
FT                   SPTR: Methyltransferase type 12; PFAM: Methyltransferase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46950"
FT                   /db_xref="GOA:E6S846"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6S846"
FT                   /protein_id="ADU46950.1"
FT                   /translation="MDTEHFDEKAATWDDDPGKRRQARDVARAVAAAVPVGEGTRLLEY
FT                   GAGTALVTEELLASVGPVSRVTLADNSPGMRAVLREKALSGALPADTAILDLDLEDQSA
FT                   PPDRFDLIVSSMFMHHVRRLPVVLSAFAELLVDGGRVCIADLDREDGTFHTHDFDGHHG
FT                   FDRGELRTGLEQAGLVDVTITDCTHIERDGVTYSVFLATAVKGTD"
     atggacaccg aacacttcga cgagaaggcc gcgacgtggg acgacgatcc cgggaagcgc        60
     aggcaggcgc gggacgtcgc ccgggcggtc gcagcggcgg tgccggtggg cgaggggacc       120
     cggctgctcg agtacggcgc cggaacggct ctcgtgacgg aggagctgct cgcctcggtc       180
     ggcccggtca gccgggtcac gctggcggac aactcccccg gaatgcgggc cgtgctgcgc       240
     gagaaggccc tctccggcgc cctccccgcc gacaccgcca tcctcgacct ggacctggag       300
     gaccagtcgg cgccgcccga ccgcttcgac ctgatcgtgt cgtcgatgtt catgcaccac       360
     gtgcggaggc tgccggtggt gctctccgcg ttcgccgagc tgctcgtcga cggtggccgc       420
     gtctgcatcg ccgacctgga ccgggaggac ggcacgttcc acacccacga cttcgatggg       480
     caccacgggt tcgaccgggg cgagctcagg accggcctcg agcaggccgg gctcgtcgac       540
     gtcaccatca cggactgcac ccacatcgag cgggacggcg tcacctactc ggtcttcctg       600
     gccaccgcgg tcaagggcac tgactga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page