(data stored in ACNUC7421 zone)

EMBL: CP002343.PE389

CP002343.PE389       Location/Qualifiers
FT   CDS_pept        435055..437523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0402"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG0404 Glycine cleavage system T protein
FT                   (aminomethyltransferase); InterPro IPR006076: IPR006222:
FT                   IPR013977; KEGG: nca:Noca_3838 FAD dependent
FT                   oxidoreductase; PFAM: FAD dependent oxidoreductase; glycine
FT                   cleavage T protein (aminomethyl transferase); Glycine
FT                   cleavage T-protein barrel; SPTR: FAD dependent
FT                   oxidoreductase; PFAM: Aminomethyltransferase folate-binding
FT                   domain; Glycine cleavage T-protein C-terminal barrel
FT                   domain; FAD dependent oxidoreductase; TIGRFAM: glycine
FT                   cleavage system T protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46951"
FT                   /db_xref="GOA:E6S847"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6S847"
FT                   /protein_id="ADU46951.1"
FT                   /translation="MLVTVGLPDRARVVVIGGGVIGSSVAYHLAHAGWTDVVVLERDRL
FT                   TSGTTWHAAGLMTCFGSTSETSTAIRLYSRDLYARLEAETGQSTGFRPVGLIEAAADRD
FT                   RLEEYRRVAAFQRHLGLEVHEISPTEMAERFPWARTDDLLGGFFVPGDGRVNPVDLTMA
FT                   LAKGARALGVRVVEGVAVTDVLTSGGAVTGVRAAGQTIECEYVVNCTGMWARELGERNG
FT                   VVIPNQAAEHYYLITDTIEGLDPNAPVFEDPSSYGYYREEGGGMMVGLFEPEAAAWRVE
FT                   GIPSDFSFGTLPADWDRMAPFLEKAMARVPITQEVGIRTFFCGPESFTPDLAPAVGEAP
FT                   GIRGYFVAAGMNSVGILSAGGLGRVLAHWITTGRPDVDVTGFNVDRFRVDQLEPAYRAA
FT                   RTAEVLGTVYAAHTPGTQLTSARGRLLSPVHDRLVAQGGLLREVSGWEGADWFAGAGRT
FT                   PEAEPTWGRAPWFEQWEQEHRAVREAVGLMDLSFMAKFRVQGQGAGSLLDRLSAAAVNG
FT                   DPGVITYTQWLNDDGRIEADLTVTKLDDDDFWVVASDTAHGHVRAWLHRFVDATVSITD
FT                   VTVDYAQLNVQGPRSRDVLSELTDADLTTEAFGFRSAGWVELAGTRVLLARITYLGELG
FT                   YELYVPAGDALRVHDAIQSAGTTHGLRPVGLKALASLRMEKAYRDYGHDIDNTDCPLEA
FT                   GLGFALALDKPADFIGREAVLARQAANAAAGGMARRMVQVRLLDPGPLLFHAEIVLRDG
FT                   QPVGYVRAGSYGWTLGSAVGLAMVEGGGQPVTSEWLASGRWEIDVAGTRCAAAVSVRPM
FT                   YDPTSARVRL"
     gtgctcgtga ctgttggact gcccgatcgg gcgcgcgtcg tcgtcatcgg tggtggggtc        60
     atcggctcct ccgtggccta ccacctggcc cacgcaggct ggacggatgt cgtcgtgctg       120
     gagcgggacc ggctgacgtc cggcacgacc tggcacgcgg ccgggctgat gacctgcttc       180
     gggtcgacgt cagagacgag cacggcgatc cgcctctact cccgggacct ctacgcgagg       240
     ctggaggccg agaccggcca gtcgaccggc ttccgccccg tcggcctcat cgaggcggcg       300
     gctgaccggg accgcctgga ggagtaccgc cgcgttgccg cgttccagcg ccacctcggg       360
     ctggaggtgc acgagatctc gccgaccgag atggccgagc ggttcccatg ggcgaggacg       420
     gacgacctgc tcgggggctt cttcgtcccc ggcgatggcc gggtcaaccc ggtcgatctg       480
     acgatggccc tggccaaggg ggcgcgggca ctcggggtcc gggtggtcga gggcgtcgcc       540
     gtgaccgacg tgctgacctc ggggggcgcc gtcacgggtg tgcgtgcggc gggccagacg       600
     atcgagtgcg agtacgtcgt caactgcacc ggcatgtggg cgcgcgagct cggggagcgc       660
     aacggtgtcg tgatccccaa ccaggcagcg gagcactact acctcatcac cgacacgatc       720
     gaggggctcg accccaacgc gcccgtcttc gaggaccctt cgtcctacgg ctactaccgc       780
     gaggagggcg gcggcatgat ggtcggcctc ttcgagcccg aggccgcggc ctggcgcgtt       840
     gagggcatcc cgtccgactt ctccttcggg acgctgcctg ccgactggga ccggatggcg       900
     cccttcctcg agaaggcgat ggcgcgggtg ccgatcaccc aggaggtggg catccgcacc       960
     ttcttctgcg gtccggagtc cttcactccc gacctcgcac ccgccgtcgg cgaggcaccg      1020
     ggcatccgcg gttacttcgt cgcggccggg atgaactcgg tcggcatcct gtccgccggt      1080
     ggcctcggcc gcgtcctcgc ccactggatc acgacggggc ggcccgacgt cgacgtgacg      1140
     ggcttcaacg tcgaccggtt ccgggtcgac cagctcgagc cggcctatcg ggccgcccgc      1200
     acggccgagg tcctcgggac ggtgtatgcc gctcacaccc cgggcacgca gctgacctcc      1260
     gcgcggggtc ggctcctctc gccggtccac gaccggctcg tcgcgcaggg cggcttgctc      1320
     cgcgaggtgt ccggctggga aggcgccgac tggttcgcgg gagcggggcg gacaccggaa      1380
     gccgagccga cctggggtcg agcgccgtgg ttcgagcagt gggagcagga gcaccgggcg      1440
     gtccgggagg cggtcgggct gatggacctg tccttcatgg cgaagttccg ggtgcagggc      1500
     cagggggccg gctccctgct ggatcgcctg tcggcggcag ccgtcaacgg ggacccggga      1560
     gtgatcacct acacccagtg gctcaacgac gacggacgga tcgaggccga cctcaccgtg      1620
     accaagctcg acgacgacga cttctgggtc gtcgcgtcgg acacggcaca cggccacgtc      1680
     cgggcctggc tgcaccggtt cgtcgacgcg accgtctcga tcaccgacgt gacggtcgac      1740
     tacgcacagc tcaatgtgca ggggccgcgg tctcgtgacg tcctctcgga gctcaccgac      1800
     gccgacctga ccaccgaggc attcggcttc cgcagcgccg gctgggtcga gctggctggc      1860
     acccgcgtgc tcctcgcccg gatcacctac ctcggcgagc tcggctacga gctctacgtg      1920
     ccggcgggtg acgcgctccg ggtccacgac gcgatccagt ccgccggcac cactcacggc      1980
     ctgcgcccag tggggctcaa ggcgctcgcc tccctccgga tggagaaggc ttaccgggac      2040
     tacggccacg acatcgacaa cacggactgc cccctcgagg ccgggctggg cttcgccctc      2100
     gctctggaca agcccgcgga cttcatcggt cgggaggcgg tgctggcccg gcaggcagcc      2160
     aacgccgcgg ctggtgggat ggcgcggcgg atggtccagg tccgcctgct ggacccgggg      2220
     ccgctcctct tccacgccga gatcgtgctg cgggacggtc agccggtcgg gtacgtgcgg      2280
     gccggttcct acgggtggac cctcggctcg gccgtggggc tggccatggt cgaaggtggg      2340
     ggccagccgg tgacctccga gtggctcgca agcggcaggt gggagatcga cgtcgcaggg      2400
     acccggtgtg cggcagcggt ctccgtgcgc ccgatgtatg accccaccag cgcccgcgtc      2460
     cgactctga                                                              2469
//

If you have problems or comments...

PBIL Back to PBIL home page