(data stored in ACNUC7421 zone)

EMBL: CP002343.PE39

CP002343.PE39        Location/Qualifiers
FT   CDS_pept        complement(44017..44244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0039"
FT                   /product="DNA methylase N-4/N-6 domain-containing protein"
FT                   /note="KEGG: bph:Bphy_3423 DNA methylase N-4/N-6
FT                   domain-containing protein; SPTR: DNA methylase N-4/N-6
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46601"
FT                   /db_xref="GOA:E6SEK0"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEK0"
FT                   /protein_id="ADU46601.1"
FT                   /translation="MAERRKPGAIRDAILSAFEGPANRNAELTVADIRERVSAKLGEDV
FT                   PSSSVRSYLNINTPGQFIRTGRGTYRLVRR"
     gtggccgagc gccgcaagcc cggggccatc agggacgcca tcctgtccgc attcgaaggc        60
     ccagccaaca ggaacgccga gctgaccgtc gccgatatcc gcgagcgggt ctctgcgaag       120
     cttggcgaag acgtgccgtc gtcttctgtg cggtcatacc tcaacatcaa cactcccgga       180
     cagttcatcc ggaccgggcg cggaacctac cggctggtgc gccgttga                    228
//

If you have problems or comments...

PBIL Back to PBIL home page