(data stored in SCRATCH zone)

EMBL: CP002343.PE390

CP002343.PE390       Location/Qualifiers
FT   CDS_pept        complement(437648..437890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0403"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dze:Dd1591_1431 major facilitator superfamily
FT                   MFS_1; SPTR: Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46952"
FT                   /db_xref="UniProtKB/TrEMBL:E6S848"
FT                   /protein_id="ADU46952.1"
FT                   /translation="MRKNWLARTALIITLGAAPLALAIPASAATGPAPGTGLTGACNML
FT                   QAILPSGAGMGHAMTVDAPQGNAGMWRAVDVSGCS"
     atgaggaaga actggctcgc caggaccgcg ctgatcatca ccctcggggc tgcacccctg        60
     gctctcgcca tccccgcttc ggcggcaacc ggacctgcgc cgggcaccgg actgaccggc       120
     gcgtgcaaca tgctgcaggc gatcctgcct tcaggcgccg gcatgggaca cgccatgacc       180
     gtcgacgccc cccagggcaa cgccggcatg tggcgcgccg tcgatgtctc cggttgcagc       240
     tga                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page