(data stored in ACNUC7421 zone)

EMBL: CP002343.PE392

CP002343.PE392       Location/Qualifiers
FT   CDS_pept        complement(438379..441219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0405"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="COGs: COG3899 ATPase; InterPro IPR000792; KEGG:
FT                   sen:SACE_5520 LuxR family transcriptional regulator; PFAM:
FT                   regulatory protein LuxR; SMART: regulatory protein LuxR;
FT                   SPTR: Transcriptional regulator, LuxR family; PFAM:
FT                   Bacterial regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46954"
FT                   /db_xref="GOA:E6S850"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:E6S850"
FT                   /protein_id="ADU46954.1"
FT                   /translation="MGPVARAGALVGRTEELSTLQALVRAQAGGAAAAVLVGEPGMGKT
FT                   RLLAASADLLRNHRVFRMTGFEPERQVPLGAALPFLRRIGALGRAGRQLQALLSPADPE
FT                   LGSVEPARLFEAAHRALCEVADPALVIDDLQWLDGLSRALAHYLVRAALDEGVGVLMVC
FT                   ATRPGPESAAFASSLQDLLGDSGHYVELTLGPLAGAEGAELAQALRPGLSSASAQRISS
FT                   AAAGSPFWIELAIRAGGDPGVRSTAIPALLRALGSDAVQCLAAAVIGGRPAESALLGEV
FT                   LAWPEARVAAALSELVNRGVVSAEAGWFGVAHDLVREAALNQLPHEHSRRLHRQFAAVL
FT                   RRRAEGDLQVLMEALEHEGAAGAVSTELASEIASSPQRRVLGQSGLHRLAAIAELPNPD
FT                   GTERLAVDRLLADLAEEIGDSEFALRRLKQLSETLPRRAERASAALAAARHAVELGLVP
FT                   ETVALLARARRDGWDDPWTHVGADALDFARLAWLEHDAPAAQPYRTAAIDAARDLLARA
FT                   GPIESLPLAARQAYVEAINAERVSYLMAGDMTGMLDVADEFVEATRGLGEQHLDARLFL
FT                   SVALRLLNRWPEAESRAVEVRRAARQQVHPGMEAYAGFELALVVYHLGRVAEARKLHED
FT                   ARRLCERIGASFDAADTWLCGLREVIEASAANWRTAVDSLRQQADRHQNPHYRIILRQR
FT                   AALWSARFAPADSRELVVGLLDSADTDARAAGCVRCAADLHVIGAEALARVGEVDSTRR
FT                   LLRAWDAQWPDPNARAAFHRLRADAALAAAAEESRAPELLRQVIASATAAGTRLEELWG
FT                   LIDLGSVLAGADRAAASEAWSTASRLAAELGAVSEQRLVDQRLRAIGVRRVAPSRRSAA
FT                   DASPVATLTRRELDVACLAVTGARNVDIAHTLFISPKTVEQHISRVLAKLGVHNRAELG
FT                   SRYADDLDVAADGTEK"
     atgggaccag ttgcccgggc cggcgcgctg gtgggtcgga ccgaagagct gtcgacgctg        60
     caagcgctcg tgcgcgccca ggccggcggc gcagcggccg cggtcctggt cggtgaaccc       120
     ggcatgggga agacgcgtct gctcgcggcc tccgcggacc tgctgcgcaa ccatcgcgtc       180
     tttcggatga ccggcttcga gccggagcgg caggttccct tgggcgcggc cctcccgttc       240
     ctgcgccgga tcggcgcgct gggacgcgcc ggccgccagc tccaagcgct cttgtcccct       300
     gccgacccag agctgggcag cgtggagccg gcccggctgt tcgaggccgc ccaccgcgcc       360
     ctctgcgagg tggccgaccc ggcgctcgtc atcgacgacc tgcagtggct cgacggcctg       420
     tcccgggcgc tggcccacta cctggtgcga gccgctctcg acgaaggcgt cggcgtgctg       480
     atggtctgcg cgacgcgacc cggaccggag tctgccgcct tcgcctcctc cctccaggac       540
     ctgctcggcg attccggaca ctatgtggag ctcacgctgg ggccgttggc cggcgccgag       600
     ggggctgagc tggcgcaggc tctgcgtccg gggctctcct ccgccagcgc acagcggatc       660
     tcctctgcag cagccggttc acccttctgg atcgagctgg cgatccgtgc cggcggtgac       720
     ccgggtgtgc gctccaccgc cattcccgcg ttgctccggg cgttgggctc ggacgcggtc       780
     cagtgcttgg ccgctgccgt catcggcggg cggcccgccg agtccgcctt gctcggagag       840
     gtgctggcgt ggcccgaggc gcgcgtggcc gctgcgttga gcgagctcgt caacagaggg       900
     gtcgtcagcg ccgaggcggg gtggttcgga gtcgcccacg acctggtgcg cgaagcagcg       960
     ctgaaccagc ttccccacga gcacagccga cgcctccatc gccagttcgc agcagtcctt      1020
     cgacgtcggg cagaagggga cctccaggtc ctcatggagg ccctcgagca cgaaggtgcg      1080
     gccggtgcgg tgtccaccga gctcgcatcg gagatcgcca gttcacccca gcgtcgagtc      1140
     ctcggacagt ccggactgca ccggctggca gccatcgcgg agctgccgaa ccccgatggc      1200
     accgaacggc tggccgtcga ccggttgctg gctgacctcg ctgaggagat cggcgacagc      1260
     gagttcgccc tgcggcggct gaagcagctg agcgagaccc tgccgcgccg cgccgaacgg      1320
     gcatcggctg cgctcgctgc ggcccggcac gcggtcgagc tcggtctggt cccggagacc      1380
     gttgccctgc tggcacgggc ccgacgcgac ggctgggacg acccgtggac ccacgtggga      1440
     gcggatgccc tcgacttcgc tcggttggcc tggctggagc acgacgcccc cgcggcgcag      1500
     ccctaccgga cagcagcgat cgacgccgcc cgagacctcc tcgcacgggc gggccccatc      1560
     gagtccctcc ctctggccgc ccgccaggcc tacgtcgagg cgatcaacgc agaacgtgtc      1620
     tcgtacctga tggccggaga catgacgggg atgctggacg tcgcggacga gttcgtcgag      1680
     gccaccaggg ggctgggcga gcagcacctc gacgcgcggt tgttcctcag tgtggccctg      1740
     cggctcctca accggtggcc cgaggcggag agccgagccg tcgaggtcag gcgggccgct      1800
     cgccagcagg tccatcccgg gatggaggcc tacgccggat tcgagctggc tctcgtcgtc      1860
     taccacctgg gccgggtggc tgaggctcgg aagctgcacg aggacgcgcg tcggttgtgc      1920
     gagcgcatcg gcgcctcgtt cgacgccgca gacacctggc tgtgcggcct gcgggaggtg      1980
     atcgaggcgt ccgcggccaa ctggcggacg gccgtcgact cgctccgcca gcaggcggac      2040
     cgacaccaga acccccacta ccggatcatc ctgcggcagc gggcagcact gtggtccgca      2100
     cggttcgcgc ccgccgactc gcgagagctc gtcgtggggc tcctcgactc cgctgacacg      2160
     gacgcgcggg ccgccggttg tgtccgatgc gccgccgacc tccacgtgat cggggccgag      2220
     gcgctggctc gcgtcggcga ggtggactcg acccgacgcc tgcttcgggc ctgggacgcc      2280
     cagtggccag accccaacgc ccgcgcggcg ttccaccgcc tccgggccga cgcggcgctg      2340
     gccgcggccg cagaggagag cagggcgccc gagctgctcc gtcaggtcat cgcctccgcg      2400
     acagcggcgg gcacgagact ggaagagctg tggggcctga tcgacctcgg cagcgtgctc      2460
     gccggagcgg accgggccgc ggcgagcgag gcgtggtcga ccgcatcacg actggccgcg      2520
     gagctgggcg ccgtctccga gcagcggctc gtcgaccaac ggctccgggc gatcggcgtg      2580
     cgacgagttg ccccgagccg gcggtcagct gcggacgcct cacccgttgc gaccctgacc      2640
     cgtcgcgagc tcgatgtcgc gtgtctcgcc gtcacgggcg cccgcaacgt cgacatcgcc      2700
     cacacgctgt tcatctcgcc gaagaccgtc gagcagcaca tctcgcgcgt gctggccaag      2760
     ctcggggtgc acaaccgagc ggagctcggg tcgcggtacg ccgacgacct cgacgtcgca      2820
     gccgacggca ccgagaagta g                                                2841
//

If you have problems or comments...

PBIL Back to PBIL home page