(data stored in ACNUC7421 zone)

EMBL: CP002343.PE394

CP002343.PE394       Location/Qualifiers
FT   CDS_pept        complement(442254..443009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0407"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR013216;
FT                   KEGG: cwo:Cwoe_0591 methyltransferase type 11; PFAM:
FT                   Methyltransferase type 11; SPTR: Methyltransferase type 11;
FT                   PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46956"
FT                   /db_xref="GOA:E6S852"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6S852"
FT                   /protein_id="ADU46956.1"
FT                   /translation="MTESLRETVRATYAAAAKEASASSGACCGTTTFVELNTDDRGRVV
FT                   FGAALYDTEQIEGAEKAVEASLGCGVPTAVADLHPGETVLDLGSGAGGDVLISAKRVAP
FT                   GGKAIGIDMTPEMLELARANAREAGIDNAEFVEGYLEHIPLDEDSVDVVISNCVINLAA
FT                   DKAVVLAEAARVLRPGGRFAVSDVVADEDMDEATRSDMAAFTGCIAGALTEADYRAALA
FT                   GAGFEDIEITRTHSVHRHAWAAIVRARRG"
     atgaccgaga gcctgcgtga gaccgttcgc gcaacgtacg ccgcagccgc caaggaggct        60
     tcggcttcga gcggtgcgtg ttgcggcacg acgaccttcg tcgagctgaa caccgacgac       120
     aggggccggg tcgtgttcgg cgccgccctc tatgacacgg agcagatcga gggagcggag       180
     aaggcggtcg aggcctcgct cggctgcggg gtcccgaccg ccgtggccga cctgcacccc       240
     ggagagaccg tcctcgacct cggctccgga gccgggggcg acgtcctcat ctccgccaag       300
     cgggtcgccc cgggcgggaa ggcgatcggg atcgacatga cgcccgagat gctcgagctc       360
     gcccgcgcga acgcgcgaga ggccggcatc gacaacgccg agttcgtcga gggctacctc       420
     gagcacatcc cgctcgacga ggactccgtc gacgtcgtga tctccaactg cgtcatcaac       480
     ctcgccgccg acaaggcggt ggtcctcgcg gaagcggcgc gcgtcctccg gccgggtggc       540
     cggttcgccg tctcggacgt cgtcgcggac gaggacatgg acgaggcgac ccgaagcgac       600
     atggcggcgt tcaccggctg catcgccggc gcgttgaccg aggcggacta ccgggcagct       660
     ctggcgggtg ccggtttcga ggacatcgag atcacgcgca cccattcggt ccacaggcac       720
     gcctgggccg ccatcgtccg cgcccggcgc ggctga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page