(data stored in ACNUC7421 zone)

EMBL: CP002343.PE398

CP002343.PE398       Location/Qualifiers
FT   CDS_pept        complement(445332..446888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0412"
FT                   /product="protein of unknown function DUF853 NPT hydrolase"
FT                   /note="COGs: COG0433 ATPase; InterPro IPR008571; KEGG:
FT                   krh:KRH_08710 hypothetical protein; PFAM: protein of
FT                   unknown function DUF853 NPT hydrolase; SPTR: Putative
FT                   uncharacterized protein; PFAM: Bacterial protein of unknown
FT                   function (DUF853)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:E6S856"
FT                   /protein_id="ADU46960.1"
FT                   /translation="MTDPAAAATQLDEIVSGYSFEGGVIKLGAAVLDGEAHPDAPVQIP
FT                   LNVLNRHGLVAGATGTGKTKTLQLMAEQLSDAGVPVFLADVKGDLSGLASPGEGGDKIT
FT                   QRAASVGMPWEGRGYPAEFYSLGGQGSGVPVRATITSFGPVLLSKVLALNATQESSLGL
FT                   IFHYADKNGLALLDLKDLRAVITYLTSDEGKADLKSLGGLSSATAGVILRNLVTFEDQG
FT                   ADRFFGEPEFDTSDFLRTTAEGKGIISCLELPQLQDRPQLFSTFLMWLLADLFHDLPEE
FT                   GDLDQPKLVFFFDEAHLLFDDASKPFMNAIEQTVRLIRSKGVGVFFVTQSPKDVPADVL
FT                   AQLGNRVQHALRAFTPDDAKALKQAIATYPHTQYDMAKLLTSLGIGEAVVTVLSEKGVP
FT                   TPVAWTRMKAPNSLMDPAPQATVDEIIARSSLTAKYAEVADRESAYELLAKRLESAPTP
FT                   AEEPDPEPTRAQPARPPKEEPGVVEQVVSSGVFRSMLRSAGTVIGREITRSIFGTSRRR
FT                   R"
     gtgaccgacc cagccgctgc agcgacccag ctcgacgaga tcgtctccgg atacagcttc        60
     gagggaggtg tcatcaagct cggcgcggcg gtgctcgacg gggaggcgca tcccgacgcc       120
     ccggtccaga tcccgctcaa cgtcctcaac cggcacggcc tcgtcgcagg ggccaccggc       180
     accggcaaga cgaagacgct ccagctcatg gccgagcagc tctccgacgc cggtgtgccg       240
     gtcttcctcg ccgacgtcaa gggcgacctg tccgggctgg ccagcccggg cgagggcggg       300
     gacaagatca cccagcgggc agcctcggtc ggcatgccgt gggagggccg gggctacccg       360
     gccgagttct actcgctcgg cggccagggc agcggggtcc cggtgcgggc cacgatcacc       420
     tcgttcggcc cggtcctgct gtccaaggtg ctcgcgctca acgcgaccca ggagagcagc       480
     ctggggctga tcttccacta cgccgacaag aacggcctgg ccctgctcga cctcaaggac       540
     ctccgggcgg tcatcacgta cctcacctcc gacgagggca aggcggacct caagtcgctc       600
     ggcgggctgt cctccgcgac ggccggggtc atcctgcgca acctcgtcac cttcgaggac       660
     cagggcgccg accgcttctt cggcgagccg gagttcgaca ccagcgactt cctccggacg       720
     acggccgagg gcaaggggat catctcctgc ctcgagctgc cccagctgca ggaccgcccg       780
     cagctcttct cgaccttcct catgtggctg ctcgccgacc tcttccacga cctgcccgag       840
     gagggcgacc tcgaccagcc gaagctcgtc ttcttcttcg acgaggcgca tctgctcttc       900
     gacgacgcga gcaaaccgtt catgaacgcc atcgagcaga cggtccgcct catccgctcc       960
     aagggagtcg gcgtcttctt cgtcacgcag tcgccgaagg acgtcccggc ggacgtcctc      1020
     gcccagctcg gcaaccgggt ccagcacgcg ctgcgcgcct tcacccccga cgacgccaag      1080
     gccctcaagc aggccatcgc gacgtatccg cacacgcagt acgacatggc caagctgctc      1140
     acatcgctcg gcatcggcga ggcggtcgtc accgtcctgt ccgagaaggg ggtcccgacg      1200
     ccggtggcct ggacccgcat gaaggcgccg aactccctga tggacccggc cccgcaggcc      1260
     accgtcgacg agatcatcgc ccgctcctcg ctgacggcga agtacgccga ggtcgcggac      1320
     cgcgagtcgg cctacgagct gctcgccaag cggctcgagt cggctccgac gccggcggag      1380
     gagcccgacc ccgagccgac ccgggcccag ccggctcggc ccccgaagga ggagccggga      1440
     gtcgtcgagc aggtcgtgtc gtccggcgtg ttccgctcga tgctccgctc ggcggggacg      1500
     gtcatcggcc gcgagatcac ccgcagcatc ttcggcacct cgcgtcggcg gcgctga         1557
//

If you have problems or comments...

PBIL Back to PBIL home page