(data stored in ACNUC7421 zone)

EMBL: CP002343.PE4

CP002343.PE4         Location/Qualifiers
FT   CDS_pept        5015..6289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="COGs: COG1195 Recombinational DNA repair ATPase
FT                   (RecF pathway); InterPro IPR003395: IPR001238: IPR018078;
FT                   KEGG: kse:Ksed_00040 DNA replication and repair protein
FT                   RecF; PFAM: SMC domain protein; SPTR: DNA replication and
FT                   repair protein recF; TIGRFAM: DNA replication and repair
FT                   protein RecF; PFAM: RecF/RecN/SMC N terminal domain;
FT                   TIGRFAM: recF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46566"
FT                   /db_xref="GOA:E6SDW3"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDW3"
FT                   /protein_id="ADU46566.1"
FT                   /translation="MHVRHLTLKDFRSYPGAEIAFSPGVTTLIGLNGQGKTNLVEAIGY
FT                   LATLGSHRVAADQPLVRFGASQAIVRGAVMSGGHETMIELEITPGRANRARLGRAPVSR
FT                   PRDVLGTLRTVLFAPEDLALVKGDPSERRRFLDDLLVQRQPRWAGVRADYDKIVKQRNA
FT                   LLKSAAPVLRPGRRGSGGGGRAAARSRPGDPPVDEARESALHTLDVWNEHLATVGSQLL
FT                   YARLRLLRDLRPDLSASYDAVSASEAGATAQYKSSLHEEAAARLAAGEVPEIPELRQSL
FT                   LDSLAAVRGAEIERGVGLVGPHRDDVVLTLGNLPAKGYASHGESWSFALGLKLAAYRLL
FT                   ARDLGDDPVLVLDDVFAELDSGRRERLAELIGDCEQVIITAAVGADVPVQLRERGHTYE
FT                   VELGQIHALPTPTPAGPAEEDGSDA"
     gtgcacgtcc gacacctgac cctcaaggac ttccgcagct atccgggggc cgagatcgcg        60
     ttctcccccg gggtgacgac gctcatcggg ctgaacggac agggcaagac caacctcgtg       120
     gaggcgatcg gctacctcgc cacgctcggc tcgcaccggg tcgcggccga ccagcccctc       180
     gtccgcttcg gtgcgagcca ggccatcgtg cgtggcgccg tcatgagcgg cggtcacgag       240
     acgatgatcg agctcgagat cacgcccggc cgggcgaacc gggcccggct cggacgggca       300
     cccgtgtcac gcccccggga cgtgctcggc accctccgga ccgtcctctt cgccccggag       360
     gacctcgccc tcgtcaaggg tgacccctct gagcggcgcc ggttcctcga cgacctgctc       420
     gtccagcggc agccgcgctg ggccggggtg cgtgcggact acgacaagat cgtcaagcag       480
     cgcaacgccc tgctcaagtc cgcggcgccc gtgctgcgtc ccgggcggcg cggttcgggt       540
     ggagggggca gagcagcggc gcgctcccga cccggggacc cgccggtcga cgaggcccgg       600
     gagtcggcac tgcacaccct ggacgtgtgg aacgagcacc tggccacggt cgggtcgcag       660
     ctgctctacg cccgcctcag gctcctccgt gacctgaggc ccgacctcag cgcgagctac       720
     gacgccgtgt cggcgagcga ggccggggcg acggcccagt acaagagctc gctgcacgag       780
     gaggcggccg caaggttggc ggcaggggag gtgccggaga ttcccgagct gcgacagtcc       840
     ctgctcgaca gcctcgcggc cgtccggggc gccgagatcg aacggggtgt cgggctggtc       900
     ggcccgcacc gcgacgacgt cgtgctgacg ttgggcaacc tgccggcgaa ggggtatgcg       960
     agccacggcg agtcgtggag cttcgcgctc gggctcaagc tcgccgccta tcggctgctg      1020
     gctcgcgacc tcggggacga ccccgtcctc gtgctcgatg acgtcttcgc cgagctggac      1080
     tccgggcgcc gggagcggct ggccgagctg atcggcgact gcgaacaggt catcatcacg      1140
     gcggccgtcg gggcggacgt gccggtgcag ctgcgggaac gcgggcacac ctatgaggtc      1200
     gagctggggc agatccacgc gctgccgacc ccgacgccgg caggcccggc ggaggaagat      1260
     ggctccgatg cctga                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page