(data stored in ACNUC7421 zone)

EMBL: CP002343.PE40

CP002343.PE40        Location/Qualifiers
FT   CDS_pept        complement(44377..45447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0040"
FT                   /product="protein of unknown function DUF262"
FT                   /note="InterPro IPR004919; KEGG: ote:Oter_2248 hypothetical
FT                   protein; PFAM: protein of unknown function DUF262; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function DUF262"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46602"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEK1"
FT                   /protein_id="ADU46602.1"
FT                   /translation="MDFSSTQETIGWFRDRYLEGTLTLKPPYQRNPVWMARQKNHLVES
FT                   VLMKMPIPEIFIQRSTDANGRTAYAVVDGQQRISALMQFIGSYSADGQEEFDQFPLDKL
FT                   TTESDWYNRCFADLTDPEKISFFGYELAVRYLNSSDEEQMKAVFRRLNSFTVPLKPQEL
FT                   RHATYIGPFSHLADKLAGDYGDFFAENRIITVGAIRRMADVEFVAELLIGTMHGPQGGS
FT                   AKIIDDYYSNYEDFEDEFPGQRKTRVKFEETMAAIERLFPDLRGSRWGNKSDFYSLFVA
FT                   LAAFLPRGSLSDRTASKLRGALREFEEEVEQRVGDEEAPVSKAAASYARGVVRAPNEKS
FT                   RRAARHASLLAVLEEA"
     atggacttca gtagcacgca ggagacgatc ggttggtttc gtgatagata tctcgagggc        60
     accctcacgc tgaagcctcc atatcagcgc aaccccgtat ggatggcacg ccagaagaac       120
     cacctggtcg agtcggtact gatgaagatg ccaattcccg aaatattcat ccagcggtct       180
     acggatgcca acggcaggac ggcatatgcc gttgtcgacg ggcagcagcg gatcagcgcc       240
     cttatgcagt ttattggcag ttactccgcc gatggccaag aagagttcga ccagttccca       300
     ctcgacaagc tgacgacaga gtccgattgg tacaaccgat gcttcgccga cctcactgac       360
     ccggagaaga tcagcttctt tggctacgaa ctggcggttc ggtacctgaa ctcgagcgac       420
     gaagagcaga tgaaggcggt cttcaggcgt ctcaacagct tcactgtccc tctaaagcct       480
     caagaacttc ggcacgccac ttacatagga ccgttctcac atctggccga caagctcgca       540
     ggagattatg gcgacttctt tgccgagaat cggatcatca ccgtaggagc gattcgtcgc       600
     atggcagacg ttgagttcgt tgcggagttg ctcattggca ctatgcacgg tcctcagggg       660
     ggttccgcga agatcatcga tgactactac tcaaactacg aggattttga agatgagttc       720
     ccggggcagc gcaagactcg cgttaagttt gaggaaacca tggcggcaat tgagcgcctg       780
     tttccggatc ttcgcggctc acgttgggga aacaagagcg acttctactc tctcttcgtc       840
     gctctggcgg cgttccttcc acggggcagc ctgagtgaca gaactgcgtc gaagctgcga       900
     ggagccctga gagaattcga ggaagaggtg gagcagcggg tcggtgatga ggaagccccc       960
     gtgtcgaagg ccgcagcctc gtacgcccgt ggtgtagtcc gagcccctaa cgagaagtcg      1020
     cgccgtgccg cccgccacgc gtcattgctt gcagtcctcg aagaggcttg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page