(data stored in ACNUC7421 zone)

EMBL: CP002343.PE401

CP002343.PE401       Location/Qualifiers
FT   CDS_pept        complement(447859..448662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0415"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="COGs: COG0395 ABC-type sugar transport system
FT                   permease component; InterPro IPR000515; KEGG: kfl:Kfla_5624
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: Probable ABC
FT                   transporter permease protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46963"
FT                   /db_xref="GOA:E6S859"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6S859"
FT                   /protein_id="ADU46963.1"
FT                   /translation="MQVSRPERLANYAILMAFAVFALYPLIGIVTAALQPDTQAPGGLP
FT                   NFQQAWDIGRFGSYLRASALVSIFVVGVSTVLSILAGFAFGTMRFRGSEALFYVMLVGI
FT                   MVPAEAIVVPLFFDLRAIGLTDTFWALALPQVAQSVAFGTFWLRAFFRSSNRSIIEAAR
FT                   LDGASTWRILWQVLVPLARPALVTLVVLTFMWTWNEFLIPLVMVPTNESLRTAPLGLGF
FT                   FSGQYTQGFALLAAGAVIVALPVVVLYLFLQRHFIAGMLEGAVRD"
     atgcaggtct cccgccccga gcgcctcgcc aactacgcga tcctgatggc cttcgccgtc        60
     ttcgcgctct acccgttgat cggcatcgtc accgctgccc tgcagcctga cacccaggct       120
     ccgggtgggc tgcccaactt ccagcaggcg tgggacatcg ggcggttcgg ctcctacctc       180
     cgggccagcg ccctcgtgtc gatcttcgtc gtgggcgtga gcaccgtcct gtcgatcctc       240
     gccggcttcg ccttcggcac catgcggttc cgcggcagcg aggccctgtt ctacgtcatg       300
     ctcgtcggca tcatggtgcc cgccgaggcg atcgtcgtgc cgctcttctt cgacctccgg       360
     gcgatcggcc tgacggacac cttctgggcg ctcgccctcc cgcaggtcgc ccagtccgtc       420
     gcgttcggga ccttctggtt gcgggccttc ttccggtcga gcaaccggtc gatcatcgag       480
     gccgcccgcc tcgacggcgc ctcgacgtgg cggatcctct ggcaggtgct cgtgccgctc       540
     gcccggccgg ccctcgtcac cctcgtcgtc ctcaccttca tgtggacgtg gaacgagttc       600
     ctcatccccc tcgtcatggt gccgaccaac gagtcgctgc gcaccgcacc gctcggcctc       660
     gggttcttct cgggccagta cacccagggt ttcgcgctgc tcgccgcagg tgccgtcatc       720
     gtcgccctgc ccgtggtcgt gctctacctt tttctccaga ggcacttcat cgccgggatg       780
     ctcgagggcg cggtccgcga ctga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page