(data stored in SCRATCH zone)

EMBL: CP002343.PE403

CP002343.PE403       Location/Qualifiers
FT   CDS_pept        complement(449567..450952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0417"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   kfl:Kfla_5626 extracellular solute-binding protein family
FT                   1; PFAM: extracellular solute-binding protein family 1;
FT                   SPTR: Sugar ABC transporter substrate-binding protein;
FT                   PFAM: Bacterial extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46965"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E6S861"
FT                   /protein_id="ADU46965.1"
FT                   /translation="MNDNQGVTMSRRVLRTIALAGLTGALGLTACTPGSGGTAGPSEPA
FT                   PNASVTTDATSLGEVTLTVWDQEVRGGQEKQMSTLVSQFQQKYPNIKVDRVSRSFDDLT
FT                   KTLRLALSGKDAPDVVQANNTRSQMGAFVTAGELVNLDPWAKAYGWDQRYPASVRAVSS
FT                   YSPDGKTFGSGSLFGLPQVGEVVGIYYSRSKLESLGLQPPTTWAELDAALAAAKDKGEV
FT                   PLVLGNLEKWPAGHVFGVVQGRYVPADQIRALGFGQPGGDWTSPENVKAAQTLVDWVDR
FT                   GYFNSGFNGQDYDPAWQSFTKGEGVFLIAGSWLQADLSAAMKDDVGFMLPPPSEAGGTA
FT                   VTTGGTGLPFAITDKAVNKDAAAAYINFITSPEAMKVLAENGNLPVVETSQQAAPDALG
FT                   KDVFAAFDAVSRADGLVPYLDWATPTMGDTLGATLQDLLAKKLSPADALARLQEDYSEF
FT                   TSK"
     gtgaacgaca accaaggagt caccatgagt cgcagggttc ttcggaccat cgccctcgcg        60
     ggcctgaccg gtgcgctggg cctgaccgcg tgcacgcccg gttccggcgg caccgccggc       120
     ccgagcgagc cggcaccgaa cgcgtccgtg acgacggacg ccacgtcgct cggggaggtc       180
     acgctcaccg tgtgggacca ggaggtccgc ggcggccagg agaagcagat gtcgacgctg       240
     gtctcccagt tccagcagaa gtaccccaac atcaaggtcg accgggtctc gcggtccttc       300
     gacgacctca ccaagaccct ccgcctcgcc ctgagcggca aggacgcccc cgacgtcgtc       360
     caggcgaaca acacgcgttc ccagatgggc gcgttcgtca cggccgggga gctggtcaac       420
     ctcgacccct gggccaaggc gtacggctgg gaccagcgct accccgcctc cgtgcgagcg       480
     gtgtcgtcgt actccccgga cggcaagacg ttcggctccg gaagcctctt cggactcccc       540
     caggtcggtg aggtcgtggg gatctactac agccgcagca agctcgagtc cctcgggctc       600
     cagccgccca cgacgtgggc ggagctcgac gcggccctgg ccgccgccaa ggacaagggc       660
     gaggtcccgc tcgtgctcgg gaacctcgag aagtggccgg ccggtcacgt gttcggggtc       720
     gtccagggcc gttatgtccc agccgaccag atccgggccc tcggcttcgg ccagccgggc       780
     ggcgactgga cctcgcccga gaacgtcaag gccgcacaga cgttggtcga ctgggtcgac       840
     cggggctact tcaactccgg tttcaacggc caggactacg accccgcctg gcagtccttc       900
     accaagggcg agggcgtctt cctcatcgcc ggctcgtggc tgcaggccga cctgtcagcc       960
     gcgatgaagg acgatgtcgg cttcatgctt cccccgccct ccgaggcagg cggcaccgcc      1020
     gtcaccaccg gaggcaccgg gctgcccttc gccatcacgg acaaggccgt gaacaaggac      1080
     gcggccgcgg cctacatcaa cttcatcacc agcccggagg cgatgaaggt gctcgccgag      1140
     aacggcaacc tgcccgtcgt cgagacctca cagcaggccg caccggacgc gctcggcaag      1200
     gacgtcttcg cggcgttcga cgcggtctcc cgcgcggacg ggctcgtccc ctacctcgac      1260
     tgggcgaccc ccaccatggg tgacacgctc ggggctacgc tccaggacct gctcgccaag      1320
     aagctgagtc ccgctgacgc cctggctcga ctccaggagg actactcgga gttcacgtcg      1380
     aagtga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page