(data stored in ACNUC7421 zone)

EMBL: CP002343.PE406

CP002343.PE406       Location/Qualifiers
FT   CDS_pept        453823..456300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0420"
FT                   /product="coagulation factor 5/8 type domain protein"
FT                   /note="COGs: COG4409 Neuraminidase (sialidase); InterPro
FT                   IPR000421: IPR017909: IPR012680; KEGG: sgr:SGR_6429
FT                   putative neuramidase; PFAM: coagulation factor 5/8 type
FT                   domain protein; Laminin G sub domain 2; SPTR: Sialidase;
FT                   PFAM: F5/8 type C domain; BNR/Asp-box repeat;
FT                   NPCBM-associated, NEW3 domain of alpha-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46968"
FT                   /db_xref="GOA:E6S864"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018905"
FT                   /db_xref="InterPro:IPR026856"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:E6S864"
FT                   /protein_id="ADU46968.1"
FT                   /translation="MHTRRAALAGLALTVSIPLTVPLSVPVAMAGAAAATAADQTGITR
FT                   TDLDHTGDGYPVYRIPALTKTTDGTLVAAYDGRPSYGDVPNNIALVVRRSTDDGSTWED
FT                   RQVVRYEAGKPGFGDPSLVTDRVTGRIWLFHAASVNQGYFGSTTGTDDADPNVLHADVS
FT                   WSDDDGLTWQHRRLTSEVKDPQWGGLFAASGEGIQIRRGPHQGRLVQQYAIRYQGGNWA
FT                   ASLISDDHGETWRFGDLLGPGMDENKVVELSDGRLMLNSRAPGGYRKVAYSSDGGETWS
FT                   GLHADDELVDPQNNGSIIRYDADAAPSSPDAAKLLFSNTATQSGRRNLTIRQSCDNGET
FT                   WPIRKVVEPGAAEYSTLTPLGDQQFGLLYERGGYQHISFARFGGDWLDGVCAPLTSRTV
FT                   TAGSPGGTAEVEVKVTSQETGAIDGGRVALDLPSGFTAPEVPVAKLSRGATATVRIPVR
FT                   MPEGAVTNAYPYTARFLSDKGSSQSGGSIVVKGGNVVLSDSTERSYDGATITDLTDRVD
FT                   AVKDLTGGAVTVRFSTTARPAVGTLLSLADPISAVRDVIVSLNGGRPYVEVRTATSTYP
FT                   IRLQSSVDVADGKVHELIAASNAGVTSLILDDAVIAQVDGQGFFADVTALTRPHTLNPS
FT                   GKPNLTLGMNRGHFSVNGGPAAPNSRWGFVGTIHSVEVSDDLRTGEELVPAAGLSIASV
FT                   SSEETAGEDGRAANAVDGNPATIWHSKWTGTAAEYPHQITVDLGQAQPLTALRYLRRAV
FT                   GTNGDIADHVVSVSDDNVSWTQVATGTFAATKGEEEVRFAPQTARYVRLEALSAVNGLQ
FT                   FAAAAELRPVRTS"
     atgcacaccc gacgcgcggc cctcgcgggc ctcgccctca ccgtgtccat ccccctgacc        60
     gtccccttga gcgtccccgt ggcgatggcc ggggcagccg ccgccaccgc cgcggaccaa       120
     actggcatca cccgcaccga cctcgaccac accggcgacg gctaccccgt ctaccgcatt       180
     cccgcgctga cgaagacgac cgacgggacg ctcgtggcgg cttatgacgg ccgccccagc       240
     tatggagacg tcccgaacaa catcgcgctc gtcgttcgtc gcagcaccga cgacggctcg       300
     acgtgggagg accggcaggt ggttcgctac gaggccggca agccgggctt cggtgacccc       360
     agcctcgtca ccgaccgggt gacgggccgg atctggctgt tccacgccgc ctccgtcaac       420
     cagggctact tcgggtccac gaccggcacc gacgacgccg accccaatgt gctccacgcc       480
     gacgtcagct ggtccgacga cgacggcctg acgtggcagc accggcggct cacgagcgag       540
     gtcaaggacc cgcagtgggg cggcctcttc gccgcctccg gcgagggcat ccagatccgg       600
     cgcggcccgc accaggggcg actcgtccag cagtacgcca tccggtacca gggcggcaac       660
     tgggcggcca gcctcatcag tgacgaccac ggcgagacgt ggcgcttcgg ggacctgctc       720
     ggccccggca tggacgagaa caaggtggtc gagctctcgg acgggcggct catgctcaac       780
     tctcgggcgc ccggcggata ccgcaaggtc gcctactcga gcgacggcgg cgagacgtgg       840
     tcggggctgc acgccgacga cgagctggtc gacccgcaga acaacgggtc gatcatccgc       900
     tacgacgcgg acgcggcccc gagctcaccg gacgccgcca agctcctctt cagcaacacg       960
     gcgacgcaga gcggccgccg caacctgacg atccgacagt cgtgcgacaa cggggagacc      1020
     tggccgatcc gcaaggtcgt cgagccgggc gccgccgagt actccaccct cacgcccttg      1080
     ggagaccagc agttcggcct gctctacgag cggggtggct accagcacat cagcttcgcg      1140
     cggttcggtg gcgactggct cgacggcgtc tgcgcgccgc tcacgagccg cacggtcacg      1200
     gcgggctccc cgggcggaac cgccgaggtc gaggtgaagg tgacgagcca ggagaccggt      1260
     gccatcgacg gaggcagggt ggccctcgac ctgccgtcgg gcttcaccgc gcccgaggtc      1320
     ccggtcgcga agctgagccg cggggccacg gcgacggtgc ggatcccggt ccggatgccc      1380
     gagggagcgg tgaccaacgc ctacccgtac accgcccggt tcctcagcga caagggttcc      1440
     tcccagagcg gcgggagcat cgtggtcaag ggcggcaacg tcgtcctcag cgactcgacc      1500
     gagcgcagct acgacggagc gacgatcacg gacctcaccg accgggtcga cgcggtgaag      1560
     gacctcaccg gcggcgccgt gaccgtgcgc ttcagcacga cggcccgccc cgccgtgggc      1620
     acgctcctgt ccctggccga ccccatcagc gccgtccgtg acgtcatcgt ctcgctcaac      1680
     ggtgggcggc cctacgtcga ggtgcgcacc gcgacgagca cctacccgat ccggctgcag      1740
     agcagtgtcg acgtcgccga cggcaaggtt cacgagctca tcgcggcgag caacgccggg      1800
     gtcacctcgc tgatcctcga cgatgccgtc atcgcccagg tcgacggtca ggggttcttc      1860
     gccgacgtca cggccctgac ccgcccgcac accctcaacc cgagcggcaa gccgaacctc      1920
     accctcggca tgaaccgcgg tcacttctcc gtcaacggcg gccccgctgc gccgaacagc      1980
     cgctggggct tcgtcggcac gatccacagc gtcgaggtct ccgacgacct gcggaccggc      2040
     gaggagctgg tcccggccgc cggactctcg atcgcctcgg tctccagcga ggagaccgcc      2100
     ggtgaggacg gtcgcgccgc caacgccgtc gacggcaacc cagcgacgat ctggcactcg      2160
     aagtggaccg gcaccgcggc cgagtacccg caccagatca ccgtggacct cggccaggcg      2220
     cagcccctca ccgcgctgcg ctacctgcgg cgcgccgtcg ggacgaacgg cgacatcgcc      2280
     gaccacgtcg tctcggtgag cgacgacaac gtctcgtgga cccaggttgc gacgggcacg      2340
     ttcgccgcga cgaagggtga ggaggaggtc cgcttcgcac cccaaacggc gcgctacgtg      2400
     cggctcgagg cgctcagtgc cgtcaacgga ctgcagttcg ccgcggccgc cgagctccgc      2460
     cccgtccgca ccagctga                                                    2478
//

If you have problems or comments...

PBIL Back to PBIL home page