(data stored in ACNUC7421 zone)

EMBL: CP002343.PE407

CP002343.PE407       Location/Qualifiers
FT   CDS_pept        complement(456490..457497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0421"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="COGs: COG0078 Ornithine carbamoyltransferase;
FT                   InterPro IPR006132: IPR006131: IPR002292: IPR006130; KEGG:
FT                   sma:SAV_2319 ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain; SPTR: Ornithine
FT                   carbamoyltransferase; TIGRFAM: ornithine
FT                   carbamoyltransferase; PFAM: Aspartate/ornithine
FT                   carbamoyltransferase, carbamoyl-P binding domain;
FT                   Aspartate/ornithine carbamoyltransferase, Asp/Orn binding
FT                   domain; TIGRFAM: ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46969"
FT                   /db_xref="GOA:E6S865"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:E6S865"
FT                   /protein_id="ADU46969.1"
FT                   /translation="MTVASLFGRNVLKESDLTPDEFRALLDLAADLKAAKRERREQRRL
FT                   AGLNIALLFEKTSTRTRCAFEVAAADQGASTTYLDPAGSQMGHKESIKDTARVLGRYYD
FT                   GIEYRGAGHDVVETLGAWAGVPVWNGLTDDWHPTQSLCDALTMREHAAKPDSEIAFAYV
FT                   GDARFNMGNSLLVMGAMLGMDVRIAAPRSLWPSEAVVAQAKSYAAESGSRVTLTEDVAE
FT                   GIAGVDFVHTDVWVSMGEAKDVWAERIRLLTPYQVNAELLQLTGNRDVRFMHCLPAFHD
FT                   LETKVGRDVHAEFGRKELEVTDDVFESEASIVFDQAENRMHTIKALLVATLARP"
     atgaccgtgg catccctctt cggccggaac gtcctcaagg agtccgacct cacccccgac        60
     gagttccgcg ccctgctcga cctcgcggcg gatctcaagg cggccaagcg tgagcgccgt       120
     gagcagcgtc gcctcgccgg gctcaacatc gcgctgctct tcgagaagac ctcgacccgc       180
     acgcggtgcg ccttcgaggt cgctgccgcg gaccagggcg cgagcacgac ctacctcgat       240
     ccggccggct cgcagatggg ccacaaggag tcgatcaagg acaccgcccg tgtgctcggc       300
     cgctactacg acggcatcga gtaccgcggc gcagggcacg acgtcgtcga gacgctgggg       360
     gcgtgggccg gtgtccccgt gtggaacggc ctgacggacg actggcaccc gacgcagtcg       420
     ctctgtgacg ccctgacgat gcgcgagcac gcggcgaagc cggattccga gatcgccttc       480
     gcctacgtcg gcgacgcccg cttcaacatg ggcaactcgc tcctcgtgat gggggcgatg       540
     ctcgggatgg acgtccgcat cgccgcgccg cgctccttgt ggccgtcgga ggctgttgtc       600
     gcccaagcga agtcgtatgc cgctgagtcc ggttcccggg tcacgctcac cgaggacgtg       660
     gctgagggga tcgccggtgt cgacttcgtg cacaccgacg tgtgggtgtc catgggggag       720
     gcgaaggacg tatgggccga acggatccgg ctcctcaccc cctaccaggt caacgccgag       780
     ctgctccagc tcaccggcaa ccgagacgtg cggttcatgc actgcctgcc cgcgttccac       840
     gacctggaga cgaaggtcgg ccgggacgtc cacgcggagt tcggacgcaa ggagctggag       900
     gtgaccgacg acgtcttcga gtccgaggcg tcgatcgtct tcgaccaggc ggagaaccgg       960
     atgcacacca tcaaggcgct cctcgtcgcc accctcgcgc gcccctga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page