(data stored in SCRATCH zone)

EMBL: CP002343.PE41

CP002343.PE41        Location/Qualifiers
FT   CDS_pept        complement(45434..46099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0041"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: npu:Npun_R0144 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; manually curated"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46603"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEK2"
FT                   /protein_id="ADU46603.1"
FT                   /translation="MDSAELRRRLAQCGRGELPSLVRELVMDRVPYCFAAEQSLFPKVQ
FT                   AHLGAGLKIDPAGVRLVGSGCVGFSVAPDTFPKPFHSGSDLDFAIVSKELFDTAWHGLL
FT                   SWGHPRRHTLPGQENQWFGRRKDEIFWGWIDVKYLHFRGLRFVDDLKPLQKLRAAWFDT
FT                   FQSIGAEFPGTEIAGREVSGRLYRSEEHLIQYQAEGLRKLRYRLAVAREKEASPHGLQ"
     atggactccg cggaacttcg gcgacggctc gcccagtgcg ggaggggcga gcttccgagc        60
     ctcgtgcgag aactcgtgat ggacagggtg ccctactgct tcgcggctga acagtcacta       120
     tttccgaaag tgcaggcaca cctgggcgcc ggactgaaga tcgaccctgc cggtgtgcgg       180
     ctggtcggca gcggctgcgt cggtttcagc gtcgcaccgg acacattccc caagccattt       240
     cattccggct cagatctcga cttcgcgatc gtgtcaaagg aactcttcga cacggcgtgg       300
     cacggtttgc tgtcgtgggg ccacccgcgc cgacacacgc tccctggtca agaaaaccag       360
     tggttcggcc ggcgcaagga cgaaatcttt tggggctgga ttgacgtcaa gtacctccat       420
     ttccgtggtc ttagattcgt tgatgatctg aagccgctcc aaaagctgcg agctgcttgg       480
     ttcgacacct tccagagcat cggcgccgag ttccccggga cggagatcgc gggccgcgag       540
     gttagcggca gactatatcg cagcgaagaa catctgatcc aatatcaggc tgagggcctt       600
     cgaaagctcc gataccgact agcagtggca cgcgagaagg aggcgtcacc ccatggactt       660
     cagtag                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page