(data stored in ACNUC7421 zone)

EMBL: CP002343.PE411

CP002343.PE411       Location/Qualifiers
FT   CDS_pept        complement(461964..463658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0425"
FT                   /product="ATP-dependent DNA helicase, RecQ family"
FT                   /note="COGs: COG0514 Superfamily II DNA helicase;
FT                   InterProIPR014021: IPR001650: IPR011545: IPR014001: IPR
FT                   018329; KEGG: sro:Sros_5632 ATP-dependent DNA helicase
FT                   RecQ; PFAM: helicase domain protein; DEAD/DEAH box helicase
FT                   domain protein; SMART: helicase domain protein; DEAD-like
FT                   helicase; SPTR: ATP-dependent DNA helicase RecQ; TIGRFAM:
FT                   ATP-dependent DNA helicase, RecQ family; PFAM: Helicase
FT                   conserved C-terminal domain; DEAD/DEAH box helicase;
FT                   TIGRFAM: ATP-dependent DNA helicase, RecQ family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46973"
FT                   /db_xref="GOA:E6S869"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="UniProtKB/TrEMBL:E6S869"
FT                   /protein_id="ADU46973.1"
FT                   /translation="MTSGLARDRRRIRTTARRVFGHDLLLPGQEEGTLALLQGHDVLLV
FT                   APTGSGKSLTYQLAGTLLGGCTVVVSPLLALQQDQIDGLAEGARGLSAARLSSAESDAE
FT                   RTAVLERAAAGDLDFLFLSPEQLANPAVAEALTAVAPTLWAVDEAHCVSVWGHDFRPDY
FT                   FRLGELIARIGPARVVAMTATAARPVRRDIVARLGLAEPRTIVTGFERDNIALEVVRCV
FT                   TGDAQFETVLDTVDDAAASAGSGIVYCRTRKGAERYAAALTERGHRPVTYHAGLSQRRR
FT                   DEAHRAFMDGSADVIVATSAFGMGIDKPDVRFVVHADVPESPDTYYQEVGRAGRDGEPA
FT                   RAVLVYRPEDLSLGRFFAAPVPERADLAAVLDAVGDAGSTEPSAVTEHSPFGARKTGRL
FT                   LNLLELARQTGAGDQRRELVDAAIDRARARRSLDESRVDMMRGYAETARCRAEFLLAYF
FT                   GEQALEPCGHCDCCRAGLDGPPCPVGDQGGYSMGDRVRHGEFGEGMVTDVHGDRITVIF
FT                   EEVGCAPCPRRSSTNTTSSSRRDTPPWAGPQPKRNRASPRGALESGG"
     atgacctctg gcctcgcccg cgaccggcgt cgcatccgaa ccacggcccg gcgcgtcttc        60
     gggcacgacc tcctccttcc cgggcaggag gagggaacgc tcgcgctcct ccagggacac       120
     gacgtgctcc tcgtggcacc gacggggtcg ggcaagtccc tcacctacca gctggccggc       180
     acccttctcg gcggctgcac cgtcgtcgtc tcgccgctcc tcgcgctgca gcaggaccag       240
     atcgacgggc tggccgaggg cgcgcggggc ctcagcgccg cccggctcag ctccgcggag       300
     agcgacgcgg agcgcacggc cgtgctcgag cgggccgccg ccggagacct cgacttcctc       360
     ttcctgtcac ccgagcagct ggccaacccg gccgtcgccg aggcgctcac ggcggtcgcc       420
     ccgacgttgt gggccgtcga cgaggcgcac tgcgtctccg tctgggggca cgacttccgc       480
     ccggactact tccggctcgg cgagctcatc gcccggatcg ggccggcgcg ggtcgtggcg       540
     atgaccgcca cggccgctcg ccccgtgcgc cgcgacatcg tggcgcggct gggcctcgcc       600
     gagccgcgca ccatcgtcac cggcttcgag cgggacaaca tcgccctcga ggtggtccgg       660
     tgcgtgaccg gcgacgcgca gttcgagacg gtgctcgaca ccgtggacga cgcagcggcg       720
     tcagccgggt ccgggatcgt ctactgccgg acccgcaagg gcgccgagcg gtatgccgct       780
     gccctcaccg agcggggcca ccgtcccgtg acctaccacg ccggcctgtc gcagcggagg       840
     cgggacgagg cgcaccgggc gttcatggac ggatcggccg acgtgatcgt cgcgacgtcc       900
     gccttcggga tggggatcga caagccggac gtgcgcttcg tcgtccacgc ggacgtcccg       960
     gagtccccgg acacgtacta ccaggaagtc ggccgggccg gtcgcgacgg cgaaccggcc      1020
     cgggccgtgc tcgtctaccg tccggaggac ctgtccctgg gccgcttctt cgctgctccc      1080
     gtccctgagc gggccgacct cgcagcagtc ctcgacgctg tcggcgacgc ggggagcacg      1140
     gaaccgtccg ccgtgaccga gcacagcccg ttcggcgcga ggaagaccgg ccgcctcctc      1200
     aacctcctcg agctggcccg ccagaccgga gccggcgacc agcgtcgaga gctggttgac      1260
     gccgcgatcg accgggcgcg ggcgaggcgt tccctcgacg agtcgcgggt ggacatgatg      1320
     cgcggctacg ccgagaccgc ccgttgccgg gcggagttcc tgctggccta cttcggcgag      1380
     caggcgctcg agccgtgcgg tcactgtgac tgctgtcggg cgggcctgga cggcccgccc      1440
     tgccccgtgg gcgaccaggg cgggtactcg atgggggacc gggtgcgcca cggggagttc      1500
     ggcgagggga tggtgaccga cgtccacggg gaccggatca ccgtgatctt cgaggaggtc      1560
     ggctgcgcac cctgtccacg acggtcatcg acgaacacga cctcctcgag ccggcgtgac      1620
     accccaccgt gggccggtcc gcagccgaaa aggaatcgag cgtccccacg gggagcccta      1680
     gagtccggtg ggtga                                                       1695
//

If you have problems or comments...

PBIL Back to PBIL home page